Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HYALURONAN BINDING DOMAIN OF HUMAN CD44
 
Authors :  P. Teriete, S. Banerji, M. Noble, C. Blundell, A. Wright, A. Pickford, E. Lowe, D. Mahoney, M. Tammi, J. Kahmann, I. Campbell, A. Day, D. Jackson
Date :  19 Dec 03  (Deposition) - 04 Mar 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Lectin, Hyaluronan, Extracellular Matrix, Receptor, Link-Domain, C- Type Lectin, Sugar-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Teriete, S. Banerji, M. Noble, C. Blundell, A. Wright, A. Pickford, E. Lowe, D. Mahoney, M. Tammi, J. Kahmann, I. Campbell, A. Day, D. Jackson
Structure Of The Regulatory Hyaluronan-Binding Domain In The Inflammatory Leukocyte Homing Receptor Cd44
Mol. Cell V. 13 483 2004
PubMed-ID: 14992719  |  Reference-DOI: 10.1016/S1097-2765(04)00080-2

(-) Compounds

Molecule 1 - CD44 ANTIGEN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET19B
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System VariantDE3 PLYSS
    Expression System Vector TypePLASMID
    FragmentHYALURONAN BINDING DOMAIN, RESIDUES 20-178
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsFIRST RESIDUE IS IN FACT THE LAST RESIDUE OF THE SIGNAL PEPTIDE, AND WOULD NORMALLY BE CLEAVED
    SynonymPHAGOCYTIC GLYCOPROTEIN I, PGP-1, HUTCH-I, EXTRACELLULAR MATRIX RECEPTOR-III, ECMR-III, GP90 LYMPHOCYTE HOMING/ADHESION RECEPTOR, HERMES ANTIGEN, HYALURONATE RECEPTOR, HEPARAN SULFATE PROTEOGLYCAN, EPICAN, CDW44

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1UUH)

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:28 -A:129
2A:53 -A:118
3A:77 -A:97
4B:28 -B:129
5B:53 -B:118
6B:77 -B:97

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UUH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006490R46PCD44_HUMANPolymorphism369473842A/BR46P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006490R46PCD44_HUMANPolymorphism369473842AR46P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_006490R46PCD44_HUMANPolymorphism369473842BR46P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LINK_2PS50963 Link domain profile.CD44_HUMAN32-120
 
  2A:32-120
B:32-120
2LINK_1PS01241 Link domain signature.CD44_HUMAN53-97
 
  2A:53-97
B:53-97
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LINK_2PS50963 Link domain profile.CD44_HUMAN32-120
 
  1A:32-120
-
2LINK_1PS01241 Link domain signature.CD44_HUMAN53-97
 
  1A:53-97
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LINK_2PS50963 Link domain profile.CD44_HUMAN32-120
 
  1-
B:32-120
2LINK_1PS01241 Link domain signature.CD44_HUMAN53-97
 
  1-
B:53-97

(-) Exons   (0, 0)

(no "Exon" information available for 1UUH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:150
 aligned with CD44_HUMAN | P16070 from UniProtKB/Swiss-Prot  Length:742

    Alignment length:150
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169
           CD44_HUMAN    20 AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY 169
               SCOP domains d1uuha_ A: CD44, hyaluronan binding domain                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..ee..eeeeee......hhhhhhhhhhhh.....hhhhhhhhhh........eee..eeeeee.......hhhh.eeee........eeeee.......ee..........eeeeeeeeee.....eeeeeee...hhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------P--------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------LINK_2  PDB: A:32-120 UniProt: 32-120                                                    ------------------------------------------------- PROSITE (1)
                PROSITE (2) ---------------------------------LINK_1  PDB: A:53-97 UniProt: 53-97          ------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1uuh A  20 AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTmAQmEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY 169
                                    29        39        49        59   |  | 69        79        89        99       109       119       129       139       149       159       169
                                                                      63-MSE                                                                                                      
                                                                         66-MSE                                                                                                   

Chain B from PDB  Type:PROTEIN  Length:150
 aligned with CD44_HUMAN | P16070 from UniProtKB/Swiss-Prot  Length:742

    Alignment length:150
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169
           CD44_HUMAN    20 AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY 169
               SCOP domains d1uuhb_ B: CD44, hyaluronan binding domain                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..ee..eeeeee......hhhhhhhhhhhh.....hhhhhhhhhhh.......eee..eeeeee.......hhhh.eeee........eeeee.......ee..........eeeeeeeeee.....eeeeeee...hhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------P--------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------LINK_2  PDB: B:32-120 UniProt: 32-120                                                    ------------------------------------------------- PROSITE (1)
                PROSITE (2) ---------------------------------LINK_1  PDB: B:53-97 UniProt: 53-97          ------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1uuh B  20 AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTmAQmEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY 169
                                    29        39        49        59   |  | 69        79        89        99       109       119       129       139       149       159       169
                                                                      63-MSE                                                                                                      
                                                                         66-MSE                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1UUH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1UUH)

(-) Gene Ontology  (35, 35)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CD44_HUMAN | P16070)
molecular function
    GO:0005518    collagen binding    Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0004896    cytokine receptor activity    Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0005540    hyaluronic acid binding    Interacting selectively and non-covalently with hyaluronic acid, a polymer composed of repeating dimeric units of glucuronic acid and N-acetyl glucosamine.
    GO:0004415    hyalurononglucosaminidase activity    Catalysis of the random hydrolysis of (1->4) linkages between N-acetyl-beta-D-glucosamine and D-glucuronate residues in hyaluronate.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0051216    cartilage development    The process whose specific outcome is the progression of a cartilage element over time, from its formation to the mature structure. Cartilage elements are skeletal elements that consist of connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0044344    cellular response to fibroblast growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an fibroblast growth factor stimulus.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0030214    hyaluronan catabolic process    The chemical reactions and pathways resulting in the breakdown of hyaluronan, the naturally occurring anionic form of hyaluronic acid, any member of a group of glycosaminoglycans, the repeat units of which consist of beta-1,4 linked D-glucuronyl-beta-(1,3)-N-acetyl-D-glucosamine.
    GO:0060333    interferon-gamma-mediated signaling pathway    A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0070487    monocyte aggregation    The adhesion of one monocyte to one or more other monocytes via adhesion molecules.
    GO:0043518    negative regulation of DNA damage response, signal transduction by p53 class mediator    Any process that stops, prevents, or reduces the frequency, rate or extent of the cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0043154    negative regulation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
    GO:1902166    negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator    Any process that stops, prevents or reduces the frequency, rate or extent of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0034116    positive regulation of heterotypic cell-cell adhesion    Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
    GO:1900625    positive regulation of monocyte aggregation    Any process that activates or increases the frequency, rate or extent of monocyte aggregation.
    GO:0033138    positive regulation of peptidyl-serine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0016337    single organismal cell-cell adhesion    The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0035692    macrophage migration inhibitory factor receptor complex    A protein complex that binds macrophage migration inhibitory factor. Comprises CD74 and CD44 cell surface proteins.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1uuh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1uuh)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1uuh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CD44_HUMAN | P16070
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CD44_HUMAN | P16070
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CD44_HUMAN | P160701poz 2i83 4pz3 4pz4

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UUH)