1USK - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   L-LEUCINE-BINDING PROTEIN WITH LEUCINE BOUND

Authors :   U. Magnusson, B. Salopek-Sondi, L. A. Luck, S. L. Mowbray

Date :   25 Nov 03 (Deposition) - 18 Dec 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Leucine-Binding Protein, X-Ray Crystallography, Protein Structure, Abc Transport Systems, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   U. Magnusson, B. Salopek-Sondi, L. A. Luck, S. L. Mowbray
X-Ray Structures Of The Leucine-Binding Protein Illustrate Conformational Changes And The Basis Of Ligand Specificity
J. Biol. Chem. V. 279 8747 2004
PubMed-ID: 14672931 | Reference-DOI: 10.1074/JBC.M311890200

Molecule 1 - LEUCINE-SPECIFIC BINDING PROTEIN
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PKSTY
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Synonym	:	L-LEUCINE-BINDING PROTEIN, LS-BP, L-BP

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	LEU	4	Mod. Amino Acid	LEUCINE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	LEU	1	Mod. Amino Acid	LEUCINE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	LEU	1	Mod. Amino Acid	LEUCINE

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	LEU	1	Mod. Amino Acid	LEUCINE

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	LEU	1	Mod. Amino Acid	LEUCINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS A:78 , SER A:79 , GLY A:100 , ALA A:101 , THR A:102 , TYR A:150 , TYR A:202 , GLU A:226 , GLY A:227 , TYR A:276	BINDING SITE FOR RESIDUE LEU A1347
2	AC2	SOFTWARE	LEU B:77 , CYS B:78 , SER B:79 , GLY B:100 , ALA B:101 , THR B:102 , TYR B:150 , TYR B:202 , GLU B:226 , GLY B:227 , TYR B:276	BINDING SITE FOR RESIDUE LEU B1347
3	AC3	SOFTWARE	CYS C:78 , SER C:79 , GLY C:100 , ALA C:101 , THR C:102 , TYR C:150 , TYR C:202 , GLU C:226 , TYR C:276	BINDING SITE FOR RESIDUE LEU C1347
4	AC4	SOFTWARE	CYS D:78 , SER D:79 , GLY D:100 , ALA D:101 , THR D:102 , TYR D:150 , TYR D:202 , GLU D:226 , TYR D:276	BINDING SITE FOR RESIDUE LEU D1347

Asymmetric Unit

No.	Residues
1	A:53	-	A:78
2	B:53	-	B:78
3	C:53	-	C:78
4	D:53	-	D:78

Asymmetric Unit

No.	Residues
1	Gly A:75	-	His A:76
2	Gly B:75	-	His B:76
3	Gly C:75	-	His C:76
4	Gly D:75	-	His D:76

(no "SAP(SNP)/Variant" information available for 1USK)

(no "PROSITE Motif" information available for 1USK)

(no "Exon" information available for 1USK)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:347
 aligned with LIVK_ECOLI | P04816 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:347
                                                                                                                                                                                                                                                                                                                                                                                   369 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363     | 
          LIVK_ECOLI     24 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK-    -
               SCOP domains d1uska_ A: Leucine-binding protein                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1uskA01 A:1-120,A:250-330  [code=3.40.50.2300, no name defined]                                                         1uskA02 A:121-249,A:331-345  [code=3.40.50.2300, no name defined]                                                                1uskA01 A:1-120,A:250-330  [code=3.40.50.2300, no name defined]                  1uskA02        -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhhhhh.eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhh.hhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhheee..eee............eeeeee.....eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1usk A    1 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAKL 1347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     ||
                                                                                                                                                                                                                                                                                                                                                                                   346|
                                                                                                                                                                                                                                                                                                                                                                                   1347

Chain B from PDB  Type:PROTEIN  Length:347
 aligned with LIVK_ECOLI | P04816 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:347
                                                                                                                                                                                                                                                                                                                                                                                   369 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363     | 
          LIVK_ECOLI     24 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK-    -
               SCOP domains d1uskb_ B: Leucine-binding protein                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1uskB01 B:1-120,B:250-330  [code=3.40.50.2300, no name defined]                                                         1uskB02 B:121-249,B:331-345  [code=3.40.50.2300, no name defined]                                                                1uskB01 B:1-120,B:250-330  [code=3.40.50.2300, no name defined]                  1uskB02        -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhhh..eee...hhhhhhhhhhhhhhhh.eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhheee..eee.............eeeee.....eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1usk B    1 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAKL 1347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     ||
                                                                                                                                                                                                                                                                                                                                                                                   346|
                                                                                                                                                                                                                                                                                                                                                                                   1347

Chain C from PDB  Type:PROTEIN  Length:347
 aligned with LIVK_ECOLI | P04816 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:347
                                                                                                                                                                                                                                                                                                                                                                                   369 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363     | 
          LIVK_ECOLI     24 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK-    -
               SCOP domains d1uskc_ C: Leucine-binding protein                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1uskC01 C:1-120,C:250-330  [code=3.40.50.2300, no name defined]                                                         1uskC02 C:121-249,C:331-345  [code=3.40.50.2300, no name defined]                                                                1uskC01 C:1-120,C:250-330  [code=3.40.50.2300, no name defined]                  1uskC02        -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhhh..eee...hhhhhhhhhhhhhhh..eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhheee..eee............eeeeee.....eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1usk C    1 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAKL 1347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     ||
                                                                                                                                                                                                                                                                                                                                                                                   346|
                                                                                                                                                                                                                                                                                                                                                                                   1347

Chain D from PDB  Type:PROTEIN  Length:347
 aligned with LIVK_ECOLI | P04816 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:347
                                                                                                                                                                                                                                                                                                                                                                                   369 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363     | 
          LIVK_ECOLI     24 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK-    -
               SCOP domains d1uskd_ D: Leucine-binding protein                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1uskD01 D:1-120,D:250-330  [code=3.40.50.2300, no name defined]                                                         1uskD02 D:121-249,D:331-345  [code=3.40.50.2300, no name defined]                                                                1uskD01 D:1-120,D:250-330  [code=3.40.50.2300, no name defined]                  1uskD02        -- CATH domains
           Pfam domains (1) -Peripla_BP_6-1uskD01 D:2-341                                                                                                                                                                                                                                                                                                                        ------ Pfam domains (1)
           Pfam domains (2) -Peripla_BP_6-1uskD02 D:2-341                                                                                                                                                                                                                                                                                                                        ------ Pfam domains (2)
           Pfam domains (3) -Peripla_BP_6-1uskD03 D:2-341                                                                                                                                                                                                                                                                                                                        ------ Pfam domains (3)
           Pfam domains (4) -Peripla_BP_6-1uskD04 D:2-341                                                                                                                                                                                                                                                                                                                        ------ Pfam domains (4)
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh......eeeeeee...hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhhhh..eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhh.hhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhheee..eee.............eeeee.....eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1usk D    1 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAKL 1347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     ||
                                                                                                                                                                                                                                                                                                                                                                                   346|
                                                                                                                                                                                                                                                                                                                                                                                   1347

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Periplasmic binding protein-like I (179)

Superfamily: Periplasmic binding protein-like I (179)

Family: L-arabinose binding protein-like (114)

Protein domain: Leucine-binding protein (4)

Escherichia coli [TaxId: 562] (4)

1a	d1uska_	A:
1b	d1uskb_	B:
1c	d1uskc_	C:
1d	d1uskd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.2300, no name defined] (308)

Escherichia coli. Organism_taxid: 562. (24)

1a	1uskA02	A:121-249,A:331-345
1b	1uskB02	B:121-249,B:331-345
1c	1uskC02	C:121-249,C:331-345
1d	1uskD02	D:121-249,D:331-345
1e	1uskA01	A:1-120,A:250-330
1f	1uskB01	B:1-120,B:250-330
1g	1uskC01	C:1-120,C:250-330
1h	1uskD01	D:1-120,D:250-330

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Periplas_BP (97)

Family: Peripla_BP_6 (12)

Escherichia coli (strain K12) (9)

1a	Peripla_BP_6-1uskD01	D:2-341
1b	Peripla_BP_6-1uskD02	D:2-341
1c	Peripla_BP_6-1uskD03	D:2-341
1d	Peripla_BP_6-1uskD04	D:2-341

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (LIVK_ECOLI | P04816)

molecular function
	GO:0015190	L-leucine transmembrane transporter activity	Enables the transfer of L-leucine from one side of a membrane to the other. L-leucine is 2-amino-4-methylpentanoic acid.
biological process
	GO:1902475	L-alpha-amino acid transmembrane transport	The directed movement of L-alpha-amino acid across a membrane.
	GO:0015807	L-amino acid transport	The directed movement of L-enantiomer amino acids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006865	amino acid transport	The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0098655	cation transmembrane transport	A process in which a cation is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0015820	leucine transport	The directed movement of leucine, 2-amino-4-methylpentanoic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0030288	outer membrane-bounded periplasmic space	The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		LEU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:75 - His A:76	[ RasMol ]
		Gly B:75 - His B:76	[ RasMol ]
		Gly C:75 - His C:76	[ RasMol ]
		Gly D:75 - His D:76	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1usk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LIVK_ECOLI \| P04816
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LIVK_ECOLI \| P04816
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LIVK_ECOLI \| P04816	:	1usg 1usi 2lbp

1usg	L-LEUCINE-BINDING PROTEIN, APO FORM
1usi	L-LEUCINE-BINDING PROTEIN WITH PHENYLALANINE BOUND
2lbp

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (4, 4)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 8)

Pfam Domains (1, 4)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File