Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  L-LEUCINE-BINDING PROTEIN WITH PHENYLALANINE BOUND
 
Authors :  U. Magnusson, B. Salopek-Sondi, L. A. Luck, S. L. Mowbray
Date :  24 Nov 03  (Deposition) - 18 Dec 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  C  (1x)
Keywords :  Leucine-Binding Protein, X-Ray Crystallography, Protein Structure, Abc Transport Systems, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  U. Magnusson, B. Salopek-Sondi, L. A. Luck, S. L. Mowbray
X-Ray Structures Of The Leucine-Binding Protein Illustrate Conformational Changes And The Basis Of Ligand Specificity
J. Biol. Chem. V. 279 8747 2004
PubMed-ID: 14672931  |  Reference-DOI: 10.1074/JBC.M311890200

(-) Compounds

Molecule 1 - LEUCINE-SPECIFIC BINDING PROTEIN
    Chains: A, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PKSTY
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Synonym: L-LEUCINE-BINDING PROTEIN, LS-BP, L-BP

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AC
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1PHE2Mod. Amino AcidPHENYLALANINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1PHE1Mod. Amino AcidPHENYLALANINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1PHE1Mod. Amino AcidPHENYLALANINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:18 , LEU A:77 , CYS A:78 , SER A:79 , GLY A:100 , ALA A:101 , THR A:102 , TYR A:150 , TYR A:202 , GLU A:226 , TYR A:276BINDING SITE FOR RESIDUE PHE A1346
2AC2SOFTWARETRP C:18 , LEU C:77 , CYS C:78 , SER C:79 , GLY C:100 , ALA C:101 , THR C:102 , TYR C:150 , TYR C:202 , GLU C:226 , GLY C:227 , TYR C:276BINDING SITE FOR RESIDUE PHE C1346

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:53 -A:78
2C:53 -C:78

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:75 -His A:76
2Gly C:75 -His C:76

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1USI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1USI)

(-) Exons   (0, 0)

(no "Exon" information available for 1USI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:347
 aligned with LIVK_ECOLI | P04816 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:347
                                                                                                                                                                                                                                                                                                                                                                                   369 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363     | 
          LIVK_ECOLI     24 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK-    -
               SCOP domains d1usia_ A: Leucine-binding protein                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1usiA01 A:1-120,A:250-330  [code=3.40.50.2300, no name defined]                                                         1usiA02 A:121-249,A:331-345  [code=3.40.50.2300, no name defined]                                                                1usiA01 A:1-120,A:250-330  [code=3.40.50.2300, no name defined]                  1usiA02        -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhhhhh.eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhheee..eee.............eeeee.....eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1usi A    1 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAKF 1346
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     ||
                                                                                                                                                                                                                                                                                                                                                                                   346|
                                                                                                                                                                                                                                                                                                                                                                                   1346


Chain C from PDB  Type:PROTEIN  Length:347
 aligned with LIVK_ECOLI | P04816 from UniProtKB/Swiss-Prot  Length:369

    Alignment length:347
                                                                                                                                                                                                                                                                                                                                                                                   369 
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363     | 
          LIVK_ECOLI     24 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK-    -
               SCOP domains d1usic_ C: Leucine-binding protein                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1usiC01 C:1-120,C:250-330  [code=3.40.50.2300, no name defined]                                                         1usiC02 C:121-249,C:331-345  [code=3.40.50.2300, no name defined]                                                                1usiC01 C:1-120,C:250-330  [code=3.40.50.2300, no name defined]                  1usiC02        -- CATH domains
           Pfam domains (1) -Peripla_BP_6-1usiC01 C:2-341                                                                                                                                                                                                                                                                                                                        ------ Pfam domains (1)
           Pfam domains (2) -Peripla_BP_6-1usiC02 C:2-341                                                                                                                                                                                                                                                                                                                        ------ Pfam domains (2)
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeeeeee...hhhhhhhhhhhhhhh...eee...hhhhhhhhhhhhhhhh.eeee....hhhhhh.....eee...hhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhheee..eee.............eeeee.....eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1usi C    1 DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKAKF 1346
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     ||
                                                                                                                                                                                                                                                                                                                                                                                   346|
                                                                                                                                                                                                                                                                                                                                                                                   1346
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Periplas_BP (97)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)
Chain A,C   (LIVK_ECOLI | P04816)
molecular function
    GO:0015190    L-leucine transmembrane transporter activity    Enables the transfer of L-leucine from one side of a membrane to the other. L-leucine is 2-amino-4-methylpentanoic acid.
biological process
    GO:1902475    L-alpha-amino acid transmembrane transport    The directed movement of L-alpha-amino acid across a membrane.
    GO:0015807    L-amino acid transport    The directed movement of L-enantiomer amino acids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006865    amino acid transport    The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0098655    cation transmembrane transport    A process in which a cation is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0015820    leucine transport    The directed movement of leucine, 2-amino-4-methylpentanoic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0030288    outer membrane-bounded periplasmic space    The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PHE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:75 - His A:76   [ RasMol ]  
    Gly C:75 - His C:76   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1usi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LIVK_ECOLI | P04816
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LIVK_ECOLI | P04816
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LIVK_ECOLI | P04816: 1usg 1usk 2lbp

(-) Related Entries Specified in the PDB File

1usg L-LEUCINE-BINDING PROTEIN, APO FORM
1usk L-LEUCINE-BINDING PROTEIN WITH LEUCINE BOUND
2lbp