Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  LOW PH INDUCED, MEMBRANE FUSION CONFORMATION OF THE ENVELOPE PROTEIN OF TICK-BORNE ENCEPHALITIS VIRUS
 
Authors :  S. Bressanelli, F. A. Rey
Date :  16 Nov 03  (Deposition) - 29 Jan 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Keywords :  Envelope Protein, Membrane Fusion, Virus/Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Bressanelli, K. Stiasny, S. L. Allison, E. A. Stura, S. Duquerroy, J. Lescar, F. X. Heinz, F. A. Rey
Structure Of A Flavivirus Envelope Glycoprotein In Its Low-Ph-Induced Membrane Fusion Conformation.
Embo J. V. 23 728 2004
PubMed-ID: 14963486  |  Reference-DOI: 10.1038/SJ.EMBOJ.7600064

(-) Compounds

Molecule 1 - ENVELOPE PROTEIN
    Chains: A, B, C, D, E, F
    Organism Scientific: TICK-BORNE ENCEPHALITIS VIRUS
    Organism Taxid: 11088
    Strain: NEUDOERFL

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): ABC   
Biological Unit 2 (1x):    DEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1URZ)

(-) Sites  (0, 0)

(no "Site" information available for 1URZ)

(-) SS Bonds  (36, 36)

Asymmetric Unit
No.Residues
1A:3 -A:30
2A:60 -A:121
3A:74 -A:105
4A:92 -A:116
5A:186 -A:290
6A:307 -A:338
7B:3 -B:30
8B:60 -B:121
9B:74 -B:105
10B:92 -B:116
11B:186 -B:290
12B:307 -B:338
13C:3 -C:30
14C:60 -C:121
15C:74 -C:105
16C:92 -C:116
17C:186 -C:290
18C:307 -C:338
19D:3 -D:30
20D:60 -D:121
21D:74 -D:105
22D:92 -D:116
23D:186 -D:290
24D:307 -D:338
25E:3 -E:30
26E:60 -E:121
27E:74 -E:105
28E:92 -E:116
29E:186 -E:290
30E:307 -E:338
31F:3 -F:30
32F:60 -F:121
33F:74 -F:105
34F:92 -F:116
35F:186 -F:290
36F:307 -F:338

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Lys A:336 -Pro A:337
2Lys B:336 -Pro B:337
3Leu C:209 -Pro C:210
4Lys C:336 -Pro C:337
5Lys D:336 -Pro D:337
6Lys E:336 -Pro E:337
7Leu F:209 -Pro F:210
8Lys F:336 -Pro F:337

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1URZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1URZ)

(-) Exons   (0, 0)

(no "Exon" information available for 1URZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:382
 aligned with POLG_TBEVW | P14336 from UniProtKB/Swiss-Prot  Length:3414

    Alignment length:400
                                   291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681
           POLG_TBEVW   282 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 681
               SCOP domains d1urza2 A:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urza1 A:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzA01 A:2-51,A:135-191,A:272-299                1urzA02    1urzA03 A:63-121,A:236-256                                 1urzA02      1urzA01 A:2-5            1,A:135-191,A:272-299           1urzA02                                     1urzA03              1urzA02        1urzA01                     1urzA04 A:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee...eeeeee..eee...eeee.................eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeee..hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.------..eeeeehhhhhh....ee........hhhh.eeeeeee..eeeeee...hhhhhhhhh......eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz A   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELD------PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201 |     211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                        203    210                                                                                                                                                                                               


Chain A from PDB  Type:PROTEIN  Length:382
 aligned with Q80E47_9FLAV | Q80E47 from UniProtKB/TrEMBL  Length:721

    Alignment length:400
                                   206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596
         Q80E47_9FLAV   197 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 596
               SCOP domains d1urza2 A:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urza1 A:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzA01 A:2-51,A:135-191,A:272-299                1urzA02    1urzA03 A:63-121,A:236-256                                 1urzA02      1urzA01 A:2-5            1,A:135-191,A:272-299           1urzA02                                     1urzA03              1urzA02        1urzA01                     1urzA04 A:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee...eeeeee..eee...eeee.................eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeee..hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.------..eeeeehhhhhh....ee........hhhh.eeeeeee..eeeeee...hhhhhhhhh......eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz A   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELD------PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201 |     211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                        203    210                                                                                                                                                                                               


Chain B from PDB  Type:PROTEIN  Length:387
 aligned with POLG_TBEVW | P14336 from UniProtKB/Swiss-Prot  Length:3414

    Alignment length:400
                                   291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681
           POLG_TBEVW   282 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 681
               SCOP domains d1urzb2 B:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzb1 B:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzB01 B:2-51,B:135-191,B:272-299                1urzB02    1urzB03 B:63-121,B:236-256                                 1urzB02      1urzB01 B:2-5            1,B:135-191,B:272-299           1urzB02                                     1urzB03              1urzB02        1urzB01                     1urzB04 B:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eeeeeeeeee.........hhhhhh..eeeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee......-..eeeeehhhhhh....eee.......hhhh.eeeeeee..eeeeee...hhhhhhhhhh.....eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz B   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEH-PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201      |211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                             208 |                                                                                                                                                                                               
                                                                                                                                                                                                                                          210                                                                                                                                                                                               


Chain B from PDB  Type:PROTEIN  Length:387
 aligned with Q80E47_9FLAV | Q80E47 from UniProtKB/TrEMBL  Length:721

    Alignment length:400
                                   206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596
         Q80E47_9FLAV   197 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 596
               SCOP domains d1urzb2 B:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzb1 B:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzB01 B:2-51,B:135-191,B:272-299                1urzB02    1urzB03 B:63-121,B:236-256                                 1urzB02      1urzB01 B:2-5            1,B:135-191,B:272-299           1urzB02                                     1urzB03              1urzB02        1urzB01                     1urzB04 B:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eeeeeeeeee.........hhhhhh..eeeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee......-..eeeeehhhhhh....eee.......hhhh.eeeeeee..eeeeee...hhhhhhhhhh.....eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz B   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEH-PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201      |211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                             208 |                                                                                                                                                                                               
                                                                                                                                                                                                                                          210                                                                                                                                                                                               


Chain C from PDB  Type:PROTEIN  Length:385
 aligned with POLG_TBEVW | P14336 from UniProtKB/Swiss-Prot  Length:3414

    Alignment length:400
                                   291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681
           POLG_TBEVW   282 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 681
               SCOP domains d1urzc2 C:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzc1 C:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzC01 C:2-51,C:135-191,C:272-299                1urzC02    1urzC03 C:63-121,C:236-256                                 1urzC02      1urzC01 C:2-5            1,C:135-191,C:272-299           1urzC02                                     1urzC03              1urzC02        1urzC01                     1urzC04 C:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eee...eeee.........hhhhhh..eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee...---...eeeeehhhhhh....eee.......hhhh.eeeeeee..eeeeee...hhhhhhhhh......eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz C   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKT---LPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201   |   211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                          205 209                                                                                                                                                                                                


Chain C from PDB  Type:PROTEIN  Length:385
 aligned with Q80E47_9FLAV | Q80E47 from UniProtKB/TrEMBL  Length:721

    Alignment length:400
                                   206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596
         Q80E47_9FLAV   197 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 596
               SCOP domains d1urzc2 C:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzc1 C:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzC01 C:2-51,C:135-191,C:272-299                1urzC02    1urzC03 C:63-121,C:236-256                                 1urzC02      1urzC01 C:2-5            1,C:135-191,C:272-299           1urzC02                                     1urzC03              1urzC02        1urzC01                     1urzC04 C:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eee...eeee.........hhhhhh..eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee...---...eeeeehhhhhh....eee.......hhhh.eeeeeee..eeeeee...hhhhhhhhh......eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz C   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKT---LPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201   |   211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                          205 209                                                                                                                                                                                                


Chain D from PDB  Type:PROTEIN  Length:386
 aligned with POLG_TBEVW | P14336 from UniProtKB/Swiss-Prot  Length:3414

    Alignment length:400
                                   291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681
           POLG_TBEVW   282 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 681
               SCOP domains d1urzd2 D:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzd1 D:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzD01 D:2-51,D:135-191,D:272-299                1urzD02    1urzD03 D:63-121,D:236-256                                 1urzD02      1urzD01 D:2-5            1,D:135-191,D:272-299           1urzD02                                     1urzD03              1urzD02        1urzD01                     1urzD04 D:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eee...eeee.........hhhhhh..eeeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.....--..eeeeehhhhhh....ee........hhhh.eeeeeee..eeeeee...hhhhhhhhhh.....eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz D   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVE--PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201     | 211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                            207  |                                                                                                                                                                                               
                                                                                                                                                                                                                                          210                                                                                                                                                                                               


Chain D from PDB  Type:PROTEIN  Length:386
 aligned with Q80E47_9FLAV | Q80E47 from UniProtKB/TrEMBL  Length:721

    Alignment length:400
                                   206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596
         Q80E47_9FLAV   197 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 596
               SCOP domains d1urzd2 D:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzd1 D:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzD01 D:2-51,D:135-191,D:272-299                1urzD02    1urzD03 D:63-121,D:236-256                                 1urzD02      1urzD01 D:2-5            1,D:135-191,D:272-299           1urzD02                                     1urzD03              1urzD02        1urzD01                     1urzD04 D:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eee...eeee.........hhhhhh..eeeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.....--..eeeeehhhhhh....ee........hhhh.eeeeeee..eeeeee...hhhhhhhhhh.....eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz D   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVE--PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201     | 211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                            207  |                                                                                                                                                                                               
                                                                                                                                                                                                                                          210                                                                                                                                                                                               


Chain E from PDB  Type:PROTEIN  Length:382
 aligned with POLG_TBEVW | P14336 from UniProtKB/Swiss-Prot  Length:3414

    Alignment length:400
                                   291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681
           POLG_TBEVW   282 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 681
               SCOP domains d1urze2 E:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urze1 E:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzE01 E:2-51,E:135-191,E:272-299                1urzE02    1urzE03 E:63-121,E:236-256                                 1urzE02      1urzE01 E:2-5            1,E:135-191,E:272-299           1urzE02                                     1urzE03              1urzE02        1urzE01                     1urzE04 E:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eeeeeeeeee.................eeeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.------..eeeeehhhhhh....eee.......hhhh.eeeeee....eeeee...hhhhhhhhhh.....eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz E   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELD------PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201 |     211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                        203    210                                                                                                                                                                                               


Chain E from PDB  Type:PROTEIN  Length:382
 aligned with Q80E47_9FLAV | Q80E47 from UniProtKB/TrEMBL  Length:721

    Alignment length:400
                                   206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596
         Q80E47_9FLAV   197 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 596
               SCOP domains d1urze2 E:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urze1 E:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzE01 E:2-51,E:135-191,E:272-299                1urzE02    1urzE03 E:63-121,E:236-256                                 1urzE02      1urzE01 E:2-5            1,E:135-191,E:272-299           1urzE02                                     1urzE03              1urzE02        1urzE01                     1urzE04 E:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eeeeeeeeee.................eeeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.------..eeeeehhhhhh....eee.......hhhh.eeeeee....eeeee...hhhhhhhhhh.....eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz E   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELD------PTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201 |     211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                        203    210                                                                                                                                                                                               


Chain F from PDB  Type:PROTEIN  Length:388
 aligned with POLG_TBEVW | P14336 from UniProtKB/Swiss-Prot  Length:3414

    Alignment length:400
                                   291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681
           POLG_TBEVW   282 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 681
               SCOP domains d1urzf2 F:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzf1 F:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzF01 F:2-51,F:135-191,F:272-299                1urzF02    1urzF03 F:63-121,F:236-256                                 1urzF02      1urzF01 F:2-5            1,F:135-191,F:272-299           1urzF02                                     1urzF03              1urzF02        1urzF01                     1urzF04 F:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
           Pfam domains (1) Flavi_glycoprot-1urzF07 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF01 F:303-394                                                            ------- Pfam domains (1)
           Pfam domains (2) Flavi_glycoprot-1urzF08 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF02 F:303-394                                                            ------- Pfam domains (2)
           Pfam domains (3) Flavi_glycoprot-1urzF09 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF03 F:303-394                                                            ------- Pfam domains (3)
           Pfam domains (4) Flavi_glycoprot-1urzF10 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF04 F:303-394                                                            ------- Pfam domains (4)
           Pfam domains (5) Flavi_glycoprot-1urzF11 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF05 F:303-394                                                            ------- Pfam domains (5)
           Pfam domains (6) Flavi_glycoprot-1urzF12 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF06 F:303-394                                                            ------- Pfam domains (6)
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eee...eeee.................eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.........eeeeehhhhhh....eee.......hhhh.eeeeeee..eeeeee...hhhhhhhhh......eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz F   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160                                                                                                                                                                                                                                                 


Chain F from PDB  Type:PROTEIN  Length:388
 aligned with Q80E47_9FLAV | Q80E47 from UniProtKB/TrEMBL  Length:721

    Alignment length:400
                                   206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596
         Q80E47_9FLAV   197 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTVSSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 596
               SCOP domains d1urzf2 F:2-302 Envelope glycoprotein                                                                                                                                                                                                                                                                        d1urzf1 F:303-401 Envelope glycoprotein                                                             SCOP domains
               CATH domains 1urzF01 F:2-51,F:135-191,F:272-299                1urzF02    1urzF03 F:63-121,F:236-256                                 1urzF02      1urzF01 F:2-5            1,F:135-191,F:272-299           1urzF02                                     1urzF03              1urzF02        1urzF01                     1urzF04 F:300-401  [code=2.60.40.350, no name defined]                                                 CATH domains
           Pfam domains (1) Flavi_glycoprot-1urzF07 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF01 F:303-394                                                            ------- Pfam domains (1)
           Pfam domains (2) Flavi_glycoprot-1urzF08 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF02 F:303-394                                                            ------- Pfam domains (2)
           Pfam domains (3) Flavi_glycoprot-1urzF09 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF03 F:303-394                                                            ------- Pfam domains (3)
           Pfam domains (4) Flavi_glycoprot-1urzF10 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF04 F:303-394                                                            ------- Pfam domains (4)
           Pfam domains (5) Flavi_glycoprot-1urzF11 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF05 F:303-394                                                            ------- Pfam domains (5)
           Pfam domains (6) Flavi_glycoprot-1urzF12 F:2-301                                                                                                                                                                                                                                                                             -Flavi_glycop_C-1urzF06 F:303-394                                                            ------- Pfam domains (6)
         Sec.struct. author .eee.hhh.eee....eeeeeeeee...eeee.......eeeeeeeeeee..eeeeeee..eee...eeee.................eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeeee.hhhhheeeeeeee..------------.eeeee.....eeeee.hhh.eeeeeeeeee..hhh.eeeeee.........eeeeehhhhhh....eee.......hhhh.eeeeeee..eeeeee...hhhhhhhhh......eee..eee...eeeeeeeeee................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....ee......eeeee...eeeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1urz F   2 RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHT------------RKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR 401
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141     |   -       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401
                                                                                                                                                                           147          160
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 12)

Asymmetric Unit
(-)
Class: All beta proteins (24004)
(-)
Class: Membrane and cell surface proteins and peptides (2046)

(-) CATH Domains  (4, 24)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Architecture: 2-Layer Sandwich (8480)
(-)
Topology: Viral Envelope Glycoprotein; domain 2 (12)
(-)
Homologous Superfamily: Viral Envelope Glycoprotein, domain 2 (12)
(-)
Tick-borne encephalitis virus. Organism_taxid: 11088. Strain: neudoerfl (1)
1a1urzA02A:52-62,A:122-134,A:192-235,A:257-271
1b1urzE02E:52-62,E:122-134,E:192-235,E:257-271
1c1urzC02C:52-62,C:122-134,C:192-235,C:257-271
1d1urzD02D:52-62,D:122-134,D:192-235,D:257-271
1e1urzB02B:52-62,B:122-134,B:192-235,B:257-271
1f1urzF02F:52-62,F:122-134,F:192-235,F:257-271
(-)
Topology: Viral Envelope Glycoprotein; domain 3 (12)
(-)
Homologous Superfamily: Viral Envelope Glycoprotein, domain 3 (12)
(-)
Tick-borne encephalitis virus. Organism_taxid: 11088. Strain: neudoerfl (1)
2a1urzA03A:63-121,A:236-256
2b1urzB03B:63-121,B:236-256
2c1urzC03C:63-121,C:236-256
2d1urzD03D:63-121,D:236-256
2e1urzE03E:63-121,E:236-256
2f1urzF03F:63-121,F:236-256
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 12)

Asymmetric Unit
(-)
Clan: no clan defined [family: Flavi_glycop_C] (15)
(-)
Clan: no clan defined [family: Flavi_glycoprot] (10)

(-) Gene Ontology  (60, 77)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (POLG_TBEVW | P14336)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0008026    ATP-dependent helicase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003724    RNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a RNA helix.
    GO:0003968    RNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1); uses an RNA template, i.e. the catalysis of RNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0003725    double-stranded RNA binding    Interacting selectively and non-covalently with double-stranded RNA.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016817    hydrolase activity, acting on acid anhydrides    Catalysis of the hydrolysis of any acid anhydride.
    GO:0004482    mRNA (guanine-N7-)-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppR-RNA. m7G(5')pppR-RNA is mRNA containing an N7-methylguanine cap; R may be guanosine or adenosine.
    GO:0004483    mRNA (nucleoside-2'-O-)-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + m7G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppRm-RNA. R may be guanosine or adenosine.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0017111    nucleoside-triphosphatase activity    Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0070008    serine-type exopeptidase activity    Catalysis of the hydrolysis of a peptide bond not more than three residues from the N- or C-terminus of a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006370    7-methylguanosine mRNA capping    Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
    GO:0036265    RNA (guanine-N7)-methylation    The addition of a methyl group to the N7 atom in the base portion of a guanine nucleotide residue in an RNA molecule.
    GO:0016070    RNA metabolic process    The cellular chemical reactions and pathways involving RNA, ribonucleic acid, one of the two main type of nucleic acid, consisting of a long, unbranched macromolecule formed from ribonucleotides joined in 3',5'-phosphodiester linkage.
    GO:0075512    clathrin-dependent endocytosis of virus by host cell    Any clathrin-mediated endocytosis that is involved in the uptake of a virus into a host cell. Begins by invagination of a specific region of the host cell plasma membrane around the bound virus to form a clathrin-coated pit, which then pinches off to form a clathrin-coated endocytic vesicle containing the virus.
    GO:0075509    endocytosis involved in viral entry into host cell    Any endocytosis that is involved in the uptake of a virus into a host cell.
    GO:0030683    evasion or tolerance by virus of host immune response    Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0039654    fusion of virus membrane with host endosome membrane    Fusion of a virus membrane with a host endosome membrane. Occurs after internalization of the virus through the endosomal pathway, and results in release of the virus contents into the cell.
    GO:0039520    induction by virus of host autophagy    Any process in which a virus activates or increases the frequency, rate or extent of autophagy in the host.
    GO:0080009    mRNA methylation    The posttranscriptional addition of methyl groups to specific residues in an mRNA molecule.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0039663    membrane fusion involved in viral entry into host cell    Merging of the virion membrane and a host membrane (host plasma membrane or host organelle membrane) that is involved in the uptake of a virus into a host cell.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0039503    suppression by virus of host innate immune response    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of the innate immune response of the host organism, the host's first line of defense.
    GO:0039502    suppression by virus of host type I interferon-mediated signaling pathway    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of type I interferon-mediated signaling in the host organism. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0001172    transcription, RNA-templated    The cellular synthesis of RNA on a template of RNA.
    GO:0039694    viral RNA genome replication    The replication of a viral RNA genome.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0019079    viral genome replication    Any process involved directly in viral genome replication, including viral nucleotide metabolism.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0044165    host cell endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the host cell cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The host ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0044167    host cell endoplasmic reticulum membrane    The lipid bilayer surrounding the host cell endoplasmic reticulum.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0042025    host cell nucleus    A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019031    viral envelope    The lipid bilayer of a virion that surrounds the protein capsid. May also contain glycoproteins.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

Chain A,B,C,D,E,F   (Q80E47_9FLAV | Q80E47)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0039654    fusion of virus membrane with host endosome membrane    Fusion of a virus membrane with a host endosome membrane. Occurs after internalization of the virus through the endosomal pathway, and results in release of the virus contents into the cell.
    GO:0039663    membrane fusion involved in viral entry into host cell    Merging of the virion membrane and a host membrane (host plasma membrane or host organelle membrane) that is involved in the uptake of a virus into a host cell.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019031    viral envelope    The lipid bilayer of a virion that surrounds the protein capsid. May also contain glycoproteins.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1urz)
 
  Sites
(no "Sites" information available for 1urz)
 
  Cis Peptide Bonds
    Leu C:209 - Pro C:210   [ RasMol ]  
    Leu F:209 - Pro F:210   [ RasMol ]  
    Lys A:336 - Pro A:337   [ RasMol ]  
    Lys B:336 - Pro B:337   [ RasMol ]  
    Lys C:336 - Pro C:337   [ RasMol ]  
    Lys D:336 - Pro D:337   [ RasMol ]  
    Lys E:336 - Pro E:337   [ RasMol ]  
    Lys F:336 - Pro F:337   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1urz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  POLG_TBEVW | P14336
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q80E47_9FLAV | Q80E47
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  POLG_TBEVW | P14336
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q80E47_9FLAV | Q80E47
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        POLG_TBEVW | P14336: 1n6g 1na4 1svb

(-) Related Entries Specified in the PDB File

1n6g THE STRUCTURE OF IMMATURE DENGUE-2 PRM PARTICLES
1svb ENVELOPE GLYCOPROTEIN FROM TICK-BORNE ENCEPHALITIS VIRUS