1UPQ - JenaLib

Asym./Biol. Unit

Asym./Biol. Unit - sites

collapse

expand

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Description

Title :   CRYSTAL STRUCTURE OF THE PLECKSTRIN HOMOLOGY (PH) DOMAIN OF PEPP1

Authors :   C. C. Milburn, D. Komander, M. Deak, D. R. Alessi, D. M. F. Van Aalten

Date :   09 Oct 03 (Deposition) - 07 Oct 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.48

Chains :   Asym./Biol. Unit : A

Keywords :   Ph Domain, Phosphoinositide Binding, Signal Transduction (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. C. Milburn, D. Komander, M. Deak, D. R. Alessi, D. M. F. Van Aalten
Crystal Structure Of The Pleckstrin Homology Domain Of Pepp1
To Be Published
PubMed: search

Compounds

Molecule 1 - PEPP1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Cell Line	:	BL21
	Expression System Plasmid	:	PGEX4-T1
	Expression System Taxid	:	562
	Fragment	:	PLECKSTRIN HOMOLOGY DOMAIN, RESIDUES 45-167
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Structural Features

Chains, Units

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (1, 3)

Asymmetric/Biological Unit (1, 3)

No.	Name	Count	Type	Full Name
1	SO4	3	Ligand/Ion	SULFATE ION

Sites (3, 3)

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:75 , LYS A:88 , ARG A:91 , ARG A:142 , ARG A:146 , HOH A:2117 , HOH A:2118 , HOH A:2119	BINDING SITE FOR RESIDUE SO4 A1154
2	AC2	SOFTWARE	HIS A:56 , ARG A:91 , ARG A:146 , ARG A:150 , HOH A:2120 , HOH A:2121 , HOH A:2122 , HOH A:2123	BINDING SITE FOR RESIDUE SO4 A1155
3	AC3	SOFTWARE	LYS A:63 , GLN A:64 , SER A:66 , TYR A:86 , ARG A:146 , HOH A:2032 , HOH A:2041 , HOH A:2124 , HOH A:2125 , HOH A:2126 , HOH A:2127	BINDING SITE FOR RESIDUE SO4 A1156

SS Bonds (0, 0)

(no "SS Bond" information available for 1UPQ)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 1UPQ)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 1UPQ)

PROSITE Motifs (1, 1)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PH_DOMAIN	PS50003	PH domain profile.	PKHA4_HUMAN	54-153	1	A:54-153

Exons (4, 4)

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000263265	1	ENSE00001422227	chr19:49371858-49371340	519	PKHA4_HUMAN	-	0	0	-	-
1.2	ENST00000263265	2	ENSE00000718344	chr19:49370883-49370794	90	PKHA4_HUMAN	1-28	28	0	-	-
1.3	ENST00000263265	3	ENSE00000718336	chr19:49368867-49368760	108	PKHA4_HUMAN	29-64	36	1	A:47-64	18
1.4	ENST00000263265	4	ENSE00000853366	chr19:49364949-49364877	73	PKHA4_HUMAN	65-89	25	1	A:65-89	25
1.5	ENST00000263265	5	ENSE00000853365	chr19:49364758-49364658	101	PKHA4_HUMAN	89-122	34	1	A:89-122	34
1.6	ENST00000263265	6	ENSE00000718312	chr19:49363716-49363607	110	PKHA4_HUMAN	123-159	37	1	A:123-153	31
1.7	ENST00000263265	7	ENSE00000853364	chr19:49362941-49362726	216	PKHA4_HUMAN	159-231	73	0	-	-
1.8	ENST00000263265	8	ENSE00001130298	chr19:49362396-49362117	280	PKHA4_HUMAN	231-324	94	0	-	-
1.9	ENST00000263265	9	ENSE00000853362	chr19:49360753-49360679	75	PKHA4_HUMAN	325-349	25	0	-	-
1.10	ENST00000263265	10	ENSE00000954897	chr19:49357521-49357474	48	PKHA4_HUMAN	350-365	16	0	-	-
1.11	ENST00000263265	11	ENSE00000718302	chr19:49357344-49357264	81	PKHA4_HUMAN	366-392	27	0	-	-
1.12	ENST00000263265	12	ENSE00000718297	chr19:49357088-49356939	150	PKHA4_HUMAN	393-442	50	0	-	-
1.13	ENST00000263265	13	ENSE00000718291	chr19:49355583-49355485	99	PKHA4_HUMAN	443-475	33	0	-	-
1.14	ENST00000263265	14	ENSE00001233909	chr19:49351297-49351157	141	PKHA4_HUMAN	476-522	47	0	-	-
1.15	ENST00000263265	15	ENSE00001233902	chr19:49348873-49348774	100	PKHA4_HUMAN	523-556	34	0	-	-
1.16	ENST00000263265	16	ENSE00001233897	chr19:49348703-49348627	77	PKHA4_HUMAN	556-581	26	0	-	-
1.17	ENST00000263265	17	ENSE00001233890	chr19:49344567-49344406	162	PKHA4_HUMAN	582-635	54	0	-	-
1.18	ENST00000263265	18	ENSE00001233882	chr19:49342520-49342462	59	PKHA4_HUMAN	636-655	20	0	-	-
1.19	ENST00000263265	19	ENSE00001640853	chr19:49341386-49341274	113	PKHA4_HUMAN	655-693	39	0	-	-
1.20	ENST00000263265	20	ENSE00001619444	chr19:49340808-49340355	454	PKHA4_HUMAN	693-779	87	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:107
 aligned with PKHA4_HUMAN | Q9H4M7 from UniProtKB/Swiss-Prot  Length:779

    Alignment length:107
                                    56        66        76        86        96       106       116       126       136       146       
          PKHA4_HUMAN    47 LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR 153
               SCOP domains d1upqa_ A: Phosphoinositol 3-phosphate binding protein-1, PEPP1                                             SCOP domains
               CATH domains 1upqA00 A:47-153 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)                CATH domains
               Pfam domains --------PH-1upqA01 A:55-153                                                                                 Pfam domains
         Sec.struct. author ........eeeeeeeeee.......eeeeeeeee..eeeee.........eeee.hhheeee...........eeeee......eeee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------PH_DOMAIN  PDB: A:54-153 UniProt: 54-153                                                             PROSITE
           Transcript 1 (1) Exon 1.3          Exon 1.4  PDB: A:65-89   ---------------------------------Exon 1.6  PDB: A:123-153        Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.5  PDB: A:89-122           ------------------------------- Transcript 1 (2)
                 1upq A  47 LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR 153
                                    56        66        76        86        96       106       116       126       136       146

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: PH domain-like barrel (258)

Superfamily: PH domain-like (257)

Family: Pleckstrin-homology domain (PH domain) (102)

Protein domain: Phosphoinositol 3-phosphate binding protein-1, PEPP1 (2)

Human (Homo sapiens) [TaxId: 9606] (2)

d1upqa_

CATH Domains (1, 1)

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: PH-domain like (150)

Homologous Superfamily: Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) (147)

Human (Homo sapiens) (85)

1upqA00

A:47-153

Pfam Domains (1, 1)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PH (111)

Family: PH (71)

Homo sapiens (Human) (42)

PH-1upqA01

A:55-153

Gene Ontology (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PKHA4_HUMAN | Q9H4M7)

molecular function
	GO:0005545	1-phosphatidylinositol binding	Interacting selectively and non-covalently with phosphatidylinositol, any glycophospholipid with its sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
biological process
	GO:0008150	biological_process	Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1upq)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1upq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PKHA4_HUMAN \| Q9H4M7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PKHA4_HUMAN \| Q9H4M7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	PKHA4_HUMAN \| Q9H4M7	:	1upr

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UPQ)