Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PUTATIVE GLYCINE CLEAVAGE SYSTEM TRANSCRIPTIONAL REPRESSOR
 
Authors :  D. Kumaran, S. Swaminathan
Date :  06 Aug 04  (Deposition) - 17 Aug 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.45
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Protein Structure Initiative (Psi), Domain Swapping, Act Domain, Glycine Cleavage System, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Kumaran, S. Swaminathan
Crystal Structure Of Putative Glycine Cleavage System Transcriptional Repressor
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLYCINE CLEAVAGE SYSTEM TRANSCRIPTIONAL REPRESSOR, PUTATIVE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1U8S)

(-) Sites  (0, 0)

(no "Site" information available for 1U8S)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1U8S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1U8S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1U8S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1U8S)

(-) Exons   (0, 0)

(no "Exon" information available for 1U8S)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:171
 aligned with Q9KQ45_VIBCH | Q9KQ45 from UniProtKB/TrEMBL  Length:180

    Alignment length:179
                             1                                                                                                                                                                                 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169         
         Q9KQ45_VIBCH     - -MTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSPSNITRVETTLPLLGQQHDLITMMKRTSPHDHQTHAYTVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSAQTISKDKLHSEQNQFHIAISARVDSGCNLMQLQEEFDALCTALDVQGSLNFIKN 178
               SCOP domains d1u8sa1 A:2-87 putative transcriptional repressor VC2159                              d1u8sa2 A:88-180 putative transcriptional r        epressor VC2159                            SCOP domains
               CATH domains 1u8sA01 A:2-87  [code=3.30.70.260, no name defined]                                   -1u8sA02 A:89-180  [code=3.30.70.260, no na        me defined]                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee...hhhhhhhhhhhhh..eeeeeeeeee..eeeeeeeeeehhhhhhhhhhhhhhhhhhhh.eeeeeee.........eeeeeeeee....hhhhhhhhhhhhh...eeeeeeeee.--------.eeeeeeeeee....hhhhhhhhhhhhhhhhh.eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u8s A   2 SLTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSPSNITRVETTLPLLGQQHDLITMMKRTSPHDHQTHAYTVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSAQTIS--------NQFHIAISARVDSGCNLMQLQEEFDALCTALDVQGSLNFIKN 180
                                    11        21        31        41        51        61        71        81        91       101       111       121        |-       141       151       161       171         
                                                                                                                                                          130      139                                         


Chain B from PDB  Type:PROTEIN  Length:172
 aligned with Q9KQ45_VIBCH | Q9KQ45 from UniProtKB/TrEMBL  Length:180

    Alignment length:179
                             1                                                                                                                                                                                 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169         
         Q9KQ45_VIBCH     - -MTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSPSNITRVETTLPLLGQQHDLITMMKRTSPHDHQTHAYTVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSAQTISKDKLHSEQNQFHIAISARVDSGCNLMQLQEEFDALCTALDVQGSLNFIKN 178
               SCOP domains d1u8sb1 B:2-87 putative transcriptional repressor VC2159                              d1u8sb2 B:88-180 putative transcriptional re       pressor VC2159                             SCOP domains
               CATH domains 1u8sB01 B:2-87  [code=3.30.70.260, no name defined]                                   -1u8sB02 B:89-180  [code=3.30.70.260, no nam       e defined]                                 CATH domains
           Pfam domains (1) ---ACT_6-1u8sB01 B:5-80                                                        ---------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---ACT_6-1u8sB02 B:5-80                                                        ---------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ...eeeeeeeeee...hhhhhhhhhhhh...eeeeeeeeee..eeeeeeeeeehhhhhhhhhhhhhhhhhh...eeeeeee.........eeeeeeeee.....hhhhhhhhhhhh..eeeeeeeee...-------..eeeeeeeee....hhhhhhhhhhhhhhhh..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u8s B   2 SLTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSPSNITRVETTLPLLGQQHDLITMMKRTSPHDHQTHAYTVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSAQTISK-------NQFHIAISARVDSGCNLMQLQEEFDALCTALDVQGSLNFIKN 180
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171         
                                                                                                                                                           131     139
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: ACT (34)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9KQ45_VIBCH | Q9KQ45)
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1u8s)
 
  Sites
(no "Sites" information available for 1u8s)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1u8s)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1u8s
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9KQ45_VIBCH | Q9KQ45
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9KQ45_VIBCH | Q9KQ45
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1U8S)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1U8S)