1U7T - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF ABAD/HSD10 WITH A BOUND INHIBITOR

Authors :   C. R. Kissinger, P. A. Rejto, L. A. Pelletier, R. E. Showalter, J. E. Villafranca

Date :   04 Aug 04 (Deposition) - 05 Oct 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Protein-Inhibitor Complex, Rossmann Fold, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. R. Kissinger, P. A. Rejto, L. A. Pelletier, J. A. Thomson, R. E. Showalter, M. A. Abreo, C. S. Agree, S. Margosiak, J. J. Meng, R. M. Aust, D. Vanderpool, B. Li, A. Tempczyk-Russell, J. E. Villafranca
Crystal Structure Of Human Abad/Hsd10 With A Bound Inhibitor: Implications For Design Of Alzheimer'S Disease Therapeutics
J. Mol. Biol. V. 342 943 2004
PubMed-ID: 15342248 | Reference-DOI: 10.1016/J.JMB.2004.07.071
(for further references see the PDB file header)

Molecule 1 - 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II
	Chains	:	A, B, C, D
	EC Number	:	1.1.1.35
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PMGH4
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	HADH2, ERAB, XH98G2, SCHAD
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TYPE II HADH, ENDOPLASMIC RETICULUM-ASSOCIATED AMYLOID BETA-PEPTIDE BINDING PROTEIN, SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE XH98G2, AMYLOID BETA-PEPTIDE- BINDING ALCHOHOL DEHYDROGENASE, ABAD

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 4)

No.	Name	Count	Type	Full Name
1	NAD	1	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
2	TDT	3	Ligand/Ion	1-AZEPAN-1-YL-2-PHENYL-2-(4-THIOXO-1,4-DIHYDRO-PYRAZOLO[3,4-D]PYRIMIDIN-5-YL)ETHANONE ADDUCT

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:17 , SER A:20 , GLY A:21 , LEU A:22 , ASP A:41 , LEU A:42 , ALA A:63 , ASP A:64 , VAL A:65 , CYS A:91 , ALA A:92 , GLY A:93 , ALA A:95 , VAL A:96 , ALA A:97 , VAL A:120 , THR A:153 , ALA A:154 , SER A:155 , GLN A:162 , VAL A:163 , GLN A:165 , TYR A:168 , LYS A:172 , PRO A:198 , GLY A:199 , LEU A:200 , PHE A:201 , THR A:203 , PRO A:204 , LEU A:205 , LEU A:206 , HOH A:504 , HOH A:530 , HOH A:565 , HOH A:567	BINDING SITE FOR RESIDUE TDT A 501
2	AC2	SOFTWARE	GLY B:17 , SER B:20 , GLY B:21 , LEU B:22 , ASP B:41 , LEU B:42 , ALA B:63 , ASP B:64 , VAL B:65 , CYS B:91 , ALA B:92 , GLY B:93 , THR B:153 , ALA B:154 , SER B:155 , TYR B:168 , LYS B:172 , PRO B:198 , GLY B:199 , PHE B:201 , THR B:203 , PRO B:204 , LEU B:206 , HOH B:506 , HOH B:524 , HOH B:543 , HOH B:551	BINDING SITE FOR RESIDUE NAD B 502
3	AC3	SOFTWARE	GLY C:17 , SER C:20 , GLY C:21 , LEU C:22 , ASP C:41 , ALA C:63 , ASP C:64 , VAL C:65 , CYS C:91 , ALA C:92 , GLY C:93 , ALA C:95 , ALA C:97 , VAL C:120 , THR C:153 , ALA C:154 , SER C:155 , GLN C:162 , VAL C:163 , GLN C:165 , TYR C:168 , LYS C:172 , PRO C:198 , GLY C:199 , LEU C:200 , PHE C:201 , THR C:203 , PRO C:204 , LEU C:205 , LEU C:206 , LEU C:209 , HOH C:507 , HOH C:509 , HOH C:538 , HOH C:545 , HOH C:552 , HOH C:556	BINDING SITE FOR RESIDUE TDT C 503
4	AC4	SOFTWARE	GLY D:17 , SER D:20 , GLY D:21 , LEU D:22 , ASP D:41 , LEU D:42 , ALA D:63 , ASP D:64 , VAL D:65 , CYS D:91 , ALA D:92 , GLY D:93 , ALA D:95 , VAL D:120 , THR D:153 , ALA D:154 , SER D:155 , GLN D:162 , VAL D:163 , GLN D:165 , TYR D:168 , LYS D:172 , PRO D:198 , GLY D:199 , LEU D:200 , PHE D:201 , THR D:203 , PRO D:204 , LEU D:205 , SER D:208 , LEU D:209 , HOH D:526 , HOH D:544 , HOH D:561 , HOH D:570 , HOH D:571 , HOH D:575	BINDING SITE FOR RESIDUE TDT D 504

(no "SS Bond" information available for 1U7T)

Asymmetric/Biological Unit

No.	Residues
1	Phe A:223	-	Pro A:224
2	Phe B:223	-	Pro B:224
3	Phe C:223	-	Pro C:224
4	Phe D:223	-	Pro D:224

Asymmetric/Biological Unit (3, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_015987	L	122	V	HCD2_HUMAN	Disease (MHBD deficiency)	28935476	A/B/C/D	L	122	V
2	UniProt	VAR_015988	R	130	C	HCD2_HUMAN	Disease (MHBD deficiency)	28935475	A/B/C/D	R	130	C
3	UniProt	VAR_032093	N	247	S	HCD2_HUMAN	Disease (MHBD deficiency)	122461163	A/B/C/D	N	247	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_SHORT	PS00061	Short-chain dehydrogenases/reductases family signature.	HCD2_HUMAN	155-183	4	A:155-183 B:155-183 C:155-183 D:155-183

Asymmetric/Biological Unit (6, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000168216	1a	ENSE00001038851	X:53461320-53461266	55	HCD2_HUMAN	1-9	9	4	A:7-9 B:7-9 C:7-9 D:7-9	3 3 3 3
1.2	ENST00000168216	2	ENSE00000846304	X:53460833-53460669	165	HCD2_HUMAN	10-64	55	4	A:10-64 B:10-64 C:10-64 D:10-64	55 55 55 55
1.3a	ENST00000168216	3a	ENSE00000671344	X:53459359-53459195	165	HCD2_HUMAN	65-119	55	4	A:65-119 B:65-119 C:65-119 D:65-119	55 55 55 55
1.4a	ENST00000168216	4a	ENSE00000671345	X:53459064-53458936	129	HCD2_HUMAN	120-162	43	4	A:120-162 B:120-162 C:120-162 D:120-162	43 43 43 43
1.5c	ENST00000168216	5c	ENSE00000671346	X:53458854-53458746	109	HCD2_HUMAN	163-199	37	4	A:163-199 B:163-199 C:163-199 D:163-199	37 37 37 37
1.6b	ENST00000168216	6b	ENSE00000846303	X:53458542-53458206	337	HCD2_HUMAN	199-261	63	4	A:199-261 B:199-261 C:199-261 D:199-261	63 63 63 63

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:255
 aligned with HCD2_HUMAN | Q99714 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:255
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256     
           HCD2_HUMAN     7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
               SCOP domains d1u7ta_ A: Type II 3-hydroxyacyl-CoA dehydrogenase                                                                                                                                                                                                              SCOP domains
               CATH domains 1u7tA00 A:7-261 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee...hhhhhhhhhhhhhh..eeeeee....hhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh...eeee..........ee....ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh......eeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------V-------C--------------------------------------------------------------------------------------------------------------------S-------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: A:155-183    ------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.1Exon 1.2  PDB: A:10-64 UniProt: 10-64                  Exon 1.3a  PDB: A:65-119 UniProt: 65-119               Exon 1.4a  PDB: A:120-162 UniProt: 120-162 Exon 1.5c  PDB: A:163-199            -------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.6b  PDB: A:199-261 UniProt: 199-261                      Transcript 1 (2)
                 1u7t A   7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256

Chain B from PDB  Type:PROTEIN  Length:255
 aligned with HCD2_HUMAN | Q99714 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:255
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256     
           HCD2_HUMAN     7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
               SCOP domains d1u7tb_ B: Type II 3-hydroxyacyl-CoA dehydrogenase                                                                                                                                                                                                              SCOP domains
               CATH domains 1u7tB00 B:7-261 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee...hhhhhhhhhhhhhh..eeeeee....hhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh...eeee..........ee....ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhh.hhhhhhhhhh.........hhhhhhhhhhhhhhh......eeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------V-------C--------------------------------------------------------------------------------------------------------------------S-------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: B:155-183    ------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.1Exon 1.2  PDB: B:10-64 UniProt: 10-64                  Exon 1.3a  PDB: B:65-119 UniProt: 65-119               Exon 1.4a  PDB: B:120-162 UniProt: 120-162 Exon 1.5c  PDB: B:163-199            -------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.6b  PDB: B:199-261 UniProt: 199-261                      Transcript 1 (2)
                 1u7t B   7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256

Chain C from PDB  Type:PROTEIN  Length:255
 aligned with HCD2_HUMAN | Q99714 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:255
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256     
           HCD2_HUMAN     7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
               SCOP domains d1u7tc_ C: Type II 3-hydroxyacyl-CoA dehydrogenase                                                                                                                                                                                                              SCOP domains
               CATH domains 1u7tC00 C:7-261 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee...hhhhhhhhhhhhhh..eeeeee....hhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh...eeee..........ee....ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh......eeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------V-------C--------------------------------------------------------------------------------------------------------------------S-------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: C:155-183    ------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.1Exon 1.2  PDB: C:10-64 UniProt: 10-64                  Exon 1.3a  PDB: C:65-119 UniProt: 65-119               Exon 1.4a  PDB: C:120-162 UniProt: 120-162 Exon 1.5c  PDB: C:163-199            -------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.6b  PDB: C:199-261 UniProt: 199-261                      Transcript 1 (2)
                 1u7t C   7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256

Chain D from PDB  Type:PROTEIN  Length:255
 aligned with HCD2_HUMAN | Q99714 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:255
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256     
           HCD2_HUMAN     7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
               SCOP domains d1u7td_ D: Type II 3-hydroxyacyl-CoA dehydrogenase                                                                                                                                                                                                              SCOP domains
               CATH domains 1u7tD00 D:7-261 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
           Pfam domains (1) ----adh_short-1u7tD01 D:11-187                                                                                                                                                       -------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----adh_short-1u7tD02 D:11-187                                                                                                                                                       -------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----adh_short-1u7tD03 D:11-187                                                                                                                                                       -------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----adh_short-1u7tD04 D:11-187                                                                                                                                                       -------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author .....eeeee...hhhhhhhhhhhhhh..eeeeee....hhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh...eeee..........ee....ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee....hhhhh..hhhhhhhhhhh........hhhhhhhhhhhhhhh......eeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------V-------C--------------------------------------------------------------------------------------------------------------------S-------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: D:155-183    ------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.1Exon 1.2  PDB: D:10-64 UniProt: 10-64                  Exon 1.3a  PDB: D:65-119 UniProt: 65-119               Exon 1.4a  PDB: D:120-162 UniProt: 120-162 Exon 1.5c  PDB: D:163-199            -------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.6b  PDB: D:199-261 UniProt: 199-261                      Transcript 1 (2)
                 1u7t D   7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 261
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Tyrosine-dependent oxidoreductases (503)

Protein domain: Type II 3-hydroxyacyl-CoA dehydrogenase (6)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1u7ta_	A:
1b	d1u7tb_	B:
1c	d1u7tc_	C:
1d	d1u7td_	D:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Human (Homo sapiens) (188)

1a	1u7tA00	A:7-261
1b	1u7tB00	B:7-261
1c	1u7tC00	C:7-261
1d	1u7tD00	D:7-261

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: adh_short (92)

Homo sapiens (Human) (21)

1a	adh_short-1u7tD01	D:11-187
1b	adh_short-1u7tD02	D:11-187
1c	adh_short-1u7tD03	D:11-187
1d	adh_short-1u7tD04	D:11-187

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (HCD2_HUMAN | Q99714)

molecular function
	GO:0047015	3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity	Catalysis of the reaction: NAD+ + 2-methyl-3-hydroxybutyryl-CoA = NADH + H+ + 2-methylaceto-acetyl-CoA.
	GO:0003857	3-hydroxyacyl-CoA dehydrogenase activity	Catalysis of the reaction: (S)-3-hydroxyacyl-CoA + NAD+ = 3-oxoacyl-CoA + NADH + H(+).
	GO:0051287	NAD binding	Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
	GO:0018454	acetoacetyl-CoA reductase activity	Catalysis of the reaction: (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH + H+.
	GO:0001540	amyloid-beta binding	Interacting selectively and non-covalently with amyloid-beta peptide/protein and/or its precursor.
	GO:0008709	cholate 7-alpha-dehydrogenase activity	Catalysis of the reaction: cholate + NAD(+) = 3alpha,12alpha-dihydroxy-7-oxo-5beta-cholanate + H(+) + NADH.
	GO:0004303	estradiol 17-beta-dehydrogenase activity	Catalysis of the reaction: estradiol-17-beta + NADP+ = estrone + NADPH + H+.
	GO:0030331	estrogen receptor binding	Interacting selectively and non-covalently with an estrogen receptor.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005496	steroid binding	Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
	GO:0030283	testosterone dehydrogenase [NAD(P)] activity	Catalysis of the reaction: testosterone + NAD(P)+ = androst-4-ene-3,17-dione + NAD(P)H + H+.
biological process
	GO:0033327	Leydig cell differentiation	The process in which a relatively unspecialized cell acquires specialized structural and/or functional features of a Leydig cell. A Leydig cell is a testosterone-secreting cell in the interstitial area, between the seminiferous tubules, in the testis.
	GO:0009083	branched-chain amino acid catabolic process	The chemical reactions and pathways resulting in the breakdown of amino acids containing a branched carbon skeleton, comprising isoleucine, leucine and valine.
	GO:0007569	cell aging	An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0070901	mitochondrial tRNA methylation	The posttranscriptional addition of methyl groups to specific residues in a mitochondrial tRNA molecule.
	GO:0090646	mitochondrial tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group, in the mitochondrion.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0051289	protein homotetramerization	The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TDT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Phe A:223 - Pro A:224	[ RasMol ]
		Phe B:223 - Pro B:224	[ RasMol ]
		Phe C:223 - Pro C:224	[ RasMol ]
		Phe D:223 - Pro D:224	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1u7t
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HCD2_HUMAN \| Q99714
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.35
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	300438
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HCD2_HUMAN \| Q99714
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	HCD2_HUMAN \| Q99714	:	1f67 1so8 2o23

(no "Related Entries Specified in the PDB File" available for 1U7T)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 12)

PROSITE Motifs (1, 4)

Exons (6, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (26, 26)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File