Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  COMPLEX CRYSTAL STRUCTURE OF SPE16 WITH ANS
 
Authors :  F. Wu, Z. Wei, Z. Zhou, W. Gong
Date :  02 Jul 04  (Deposition) - 25 Oct 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Seven Antiparallel Beta-Sheet, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Wu, Z. Wei, Z. Zhou, W. Gong
Complex Crystal Structure Of Spe16 With Ans
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PATHOGENESIS-RELATED CLASS 10 PROTEIN SPE-16
    ChainsA, B
    Organism ScientificPACHYRHIZUS EROSUS
    Organism Taxid109171
    SynonymPATHOGENESIS-RELATED PROTEIN CLASS 10

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric/Biological Unit (1, 5)
No.NameCountTypeFull Name
12AN5Ligand/Ion8-ANILINO-1-NAPHTHALENE SULFONATE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:36 , GLU A:59 , LYS A:138 , GLY A:141 , 2AN A:716 , HOH A:717 , LYS B:144 , GLY B:148 , LEU B:151BINDING SITE FOR RESIDUE 2AN A 715
2AC2SOFTWAREILE A:55 , ALA A:57 , SER A:64 , VAL A:66 , GLN A:68 , ILE A:84 , GLY A:89 , LYS A:138 , GLY A:139 , 2AN A:715BINDING SITE FOR RESIDUE 2AN A 716
3AC3SOFTWAREILE A:52 , LEU A:67 , LYS A:69 , VAL A:85 , LYS B:69 , VAL B:85 , LYS B:96 , HOH B:774BINDING SITE FOR RESIDUE 2AN B 719
4AC4SOFTWARELYS A:144 , GLU A:147 , LEU A:151 , PRO B:36 , GLU B:59 , LYS B:138 , 2AN B:718 , HOH B:725 , HOH B:737 , HOH B:750BINDING SITE FOR RESIDUE 2AN B 717
5AC5SOFTWAREILE B:55 , ALA B:57 , SER B:64 , VAL B:66 , GLY B:89 , LEU B:97 , PHE B:99 , ALA B:135 , LYS B:138 , 2AN B:717BINDING SITE FOR RESIDUE 2AN B 718

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TXC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TXC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TXC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TXC)

(-) Exons   (0, 0)

(no "Exon" information available for 1TXC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:157
 aligned with Q6T6J0_9FABA | Q6T6J0 from UniProtKB/TrEMBL  Length:151

    Alignment length:157
                                                                                                                                                                               151       
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       
         Q6T6J0_9FABA     2 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIETYL-------   -
               SCOP domains d1txca_ A: automated matches                                                                                                                                  SCOP domains
               CATH domains 1txcA00 A:1-157  [code=3.30.530.20, no name defined]                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee..hhhhhhhhhhhhhhhhhhhh...eeeeeeee.......eeeeeeee..eeeeeeeeeeeeehhh.eeeeeeee.......eeeeeeeeeeee.....eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1txc A   1 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIEGYVLANPAEY 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       

Chain B from PDB  Type:PROTEIN  Length:157
 aligned with Q6T6J0_9FABA | Q6T6J0 from UniProtKB/TrEMBL  Length:151

    Alignment length:157
                                                                                                                                                                               151       
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       
         Q6T6J0_9FABA     2 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIETYL-------   -
               SCOP domains d1txcb_ B: automated matches                                                                                                                                  SCOP domains
               CATH domains 1txcB00 B:1-157  [code=3.30.530.20, no name defined]                                                                                                          CATH domains
           Pfam domains (1) Bet_v_1-1txcB01 B:1-147                                                                                                                            ---------- Pfam domains (1)
           Pfam domains (2) Bet_v_1-1txcB02 B:1-147                                                                                                                            ---------- Pfam domains (2)
         Sec.struct. author .eeeeeeeeee..hhhhhhhhhhhhhhhhhhhh...eeeeeeee.......eeeeeee....eeeeeeeeeeee....eeeeeeee.......eeeeeeeeeeee.....eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1txc B   1 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIEGYVLANPAEY 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q6T6J0_9FABA | Q6T6J0)
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009607    response to biotic stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a biotic stimulus, a stimulus caused or produced by a living organism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2AN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1txc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1txc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6T6J0_9FABA | Q6T6J0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q6T6J0_9FABA | Q6T6J0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6T6J0_9FABA | Q6T6J01tw0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TXC)