Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  NATIVE CRYSTAL STRUCTURE OF SPE16
 
Authors :  F. Wu, Z. Wei, Z. Zhou, W. Gong
Date :  30 Jun 04  (Deposition) - 11 Oct 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Seven Antiparallel Beta-Sheet, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Wu, Z. Wei, Z. Zhou, W. Gong
Native Crystal Structure Of Spe16
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PATHOGENESIS-RELATED CLASS 10 PROTEIN SPE-16
    Chains: A, B
    Organism Scientific: PACHYRHIZUS EROSUS
    Organism Taxid: 109171
    Synonym: PATHOGENESIS-RELATED PROTEIN CLASS 10, SPE16

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TW0)

(-) Sites  (0, 0)

(no "Site" information available for 1TW0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TW0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TW0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TW0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TW0)

(-) Exons   (0, 0)

(no "Exon" information available for 1TW0)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:157
 aligned with Q6T6J0_9FABA | Q6T6J0 from UniProtKB/TrEMBL  Length:151

    Alignment length:157
                                                                                                                                                                               151       
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       
         Q6T6J0_9FABA     2 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIETYL-------   -
               SCOP domains d1tw0a1 A:1-147 Plant pathogenesis-related protein PR10                                                                                            ---------- SCOP domains
               CATH domains 1tw0A00 A:1-157  [code=3.30.530.20, no name defined]                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee..hhhhhhhhhhhhhhhhhhhh...eeeeeeee.......eeeeeeee..eeeeeeeeeeeee....eeeeeeee.......eeeeeeeeeeee.....eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tw0 A   1 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIEGYVLANPAEY 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       


Chain B from PDB  Type:PROTEIN  Length:157
 aligned with Q6T6J0_9FABA | Q6T6J0 from UniProtKB/TrEMBL  Length:151

    Alignment length:157
                                                                                                                                                                               151       
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       
         Q6T6J0_9FABA     2 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIETYL-------   -
               SCOP domains d1tw0b_ B: automated matches                                                                                                                                  SCOP domains
               CATH domains 1tw0B00 B:1-157  [code=3.30.530.20, no name defined]                                                                                                          CATH domains
           Pfam domains (1) Bet_v_1-1tw0B01 B:1-147                                                                                                                            ---------- Pfam domains (1)
           Pfam domains (2) Bet_v_1-1tw0B02 B:1-147                                                                                                                            ---------- Pfam domains (2)
         Sec.struct. author .eeeeeeeeee..hhhhhhhhhhhhhhhhhhhh...eeeeeeee.......eeeeeeee..eeeeeeeeeeeeehhh.eeeeeeee.......eeeeeeeeeeee.....eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tw0 B   1 GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIEGYVLANPAEY 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Bet_V_1_like (93)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q6T6J0_9FABA | Q6T6J0)
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009607    response to biotic stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a biotic stimulus, a stimulus caused or produced by a living organism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tw0)
 
  Sites
(no "Sites" information available for 1tw0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tw0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tw0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6T6J0_9FABA | Q6T6J0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6T6J0_9FABA | Q6T6J0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6T6J0_9FABA | Q6T6J0: 1txc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TW0)