|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric Unit (1, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1TW4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1TW4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1TW4) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1TW4) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:125 aligned with FABPL_CHICK | P80226 from UniProtKB/Swiss-Prot Length:126 Alignment length:125 11 21 31 41 51 61 71 81 91 101 111 121 FABPL_CHICK 2 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV 126 SCOP domains d1tw4a_ A: Liver basic fatty acid binding protein, LB_FABP SCOP domains CATH domains 1tw4A00 A:1-125 [code=2.40.128.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---FABP PDB: A:4-21 -------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 1tw4 A 1 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV 125 10 20 30 40 50 60 70 80 90 100 110 120 Chain B from PDB Type:PROTEIN Length:125 aligned with FABPL_CHICK | P80226 from UniProtKB/Swiss-Prot Length:126 Alignment length:125 11 21 31 41 51 61 71 81 91 101 111 121 FABPL_CHICK 2 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV 126 SCOP domains d1tw4b_ B: Liver basic fatty acid binding protein, LB_FABP SCOP domains CATH domains 1tw4B00 B:1-125 [code=2.40.128.20, no name defined] CATH domains Pfam domains (1) --Lipocalin-1tw4B01 B:3-125 Pfam domains (1) Pfam domains (2) --Lipocalin-1tw4B02 B:3-125 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---FABP PDB: B:4-21 -------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 1tw4 B 1 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV 125 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (FABPL_CHICK | P80226)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|