|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1MVG) |
Sites (0, 0)| (no "Site" information available for 1MVG) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1MVG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1MVG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1MVG) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1MVG) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:125 aligned with FABPL_CHICK | P80226 from UniProtKB/Swiss-Prot Length:126 Alignment length:125 11 21 31 41 51 61 71 81 91 101 111 121 FABPL_CHICK 2 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV 126 SCOP domains d1mvga_ A: Liver basic fatty acid binding protein, LB_FABP SCOP domains CATH domains 1mvgA00 A:1-125 [code=2.40.128.20, no name defined] CATH domains Pfam domains --Lipocalin-1mvgA01 A:3-125 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---FABP PDB: A:4-21 -------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 1mvg A 1 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV 125 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (FABPL_CHICK | P80226)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|