Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  F1-G MODULE PAIR RESIDUES 1-91 (C83S) OF TISSUE-TYPE PLASMINOGEN ACTIVATOR (T-PA) (NMR, 298K, PH2.95, REPRESENTATIVE STRUCTURE)
 
Authors :  B. O. Smith, A. K. Downing, P. C. Driscoll, T. J. Dudgeon, I. D. Campbell
Date :  14 Jun 95  (Deposition) - 15 Sep 95  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Plasminogen Activation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. O. Smith, A. K. Downing, P. C. Driscoll, T. J. Dudgeon, I. D. Campbell
The Solution Structure And Backbone Dynamics Of The Fibronectin Type I And Epidermal Growth Factor-Like Pair Of Modules Of Tissue-Type Plasminogen Activator.
Structure V. 3 823 1995
PubMed-ID: 7582899  |  Reference-DOI: 10.1016/S0969-2126(01)00217-9
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - T-PLASMINOGEN ACTIVATOR F1-G
    ChainsA
    EC Number3.4.21.68
    EngineeredYES
    Expression SystemSACCHAROMYCES CEREVISIAE
    Expression System CommonBAKER'S YEAST
    Expression System PlasmidPSW6
    Expression System Taxid4932
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TPG)

(-) Sites  (0, 0)

(no "Site" information available for 1TPG)

(-) SS Bonds  (5, 5)

NMR Structure
No.Residues
1A:6 -A:36
2A:34 -A:43
3A:51 -A:62
4A:56 -A:73
5A:75 -A:84

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TPG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TPG)

(-) PROSITE Motifs  (6, 5)

NMR Structure (6, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FN1_2PS51091 Fibronectin type-I domain profile.TPA_HUMAN39-81  1A:4-46
2FN1_1PS01253 Fibronectin type-I domain signature.TPA_HUMAN41-78  1A:6-43
3EGF_3PS50026 EGF-like domain profile.TPA_HUMAN82-120  1A:47-85
4EGF_1PS00022 EGF-like domain signature 1.TPA_HUMAN108-119  1A:73-84
5EGF_2PS01186 EGF-like domain signature 2.TPA_HUMAN108-119  1A:73-84
6KRINGLE_2PS50070 Kringle domain profile.TPA_HUMAN126-208
214-296
  1A:91-91
-

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002208091aENSE00002112956chr8:42065242-42065012231TPA_HUMAN-00--
1.5ENST000002208095ENSE00002181240chr8:42050729-4205063298TPA_HUMAN1-24240--
1.6ENST000002208096ENSE00001617965chr8:42048932-4204889043TPA_HUMAN25-39151A:1-44
1.7bENST000002208097bENSE00001727998chr8:42046589-42046452138TPA_HUMAN39-85471A:4-5047
1.8bENST000002208098bENSE00000692406chr8:42045534-42045424111TPA_HUMAN85-122381A:50-8738
1.9dENST000002208099dENSE00001128022chr8:42045090-42044916175TPA_HUMAN122-180591A:87-915
1.9fENST000002208099fENSE00000692402chr8:42042690-4204259992TPA_HUMAN180-211320--
1.10aENST0000022080910aENSE00000692400chr8:42040408-42040237172TPA_HUMAN211-268580--
1.11ENST0000022080911ENSE00002184621chr8:42039540-4203945586TPA_HUMAN268-297300--
1.12bENST0000022080912bENSE00001674536chr8:42038203-42038008196TPA_HUMAN297-362660--
1.13bENST0000022080913bENSE00001605389chr8:42037896-42037760137TPA_HUMAN362-408470--
1.14aENST0000022080914aENSE00001793485chr8:42037584-42037444141TPA_HUMAN408-455480--
1.15ENST0000022080915ENSE00001758697chr8:42036581-42036415167TPA_HUMAN455-510560--
1.16eENST0000022080916eENSE00002116161chr8:42033669-42032751919TPA_HUMAN511-562520--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:91
 aligned with TPA_HUMAN | P00750 from UniProtKB/Swiss-Prot  Length:562

    Alignment length:91
                                    45        55        65        75        85        95       105       115       125 
            TPA_HUMAN    36 SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRAT 126
               SCOP domains d1tpga2 A:1-50                                    d1tpga1 A:51-91                           SCOP domains
               CATH domains 1tpgA01 A:1-46 Complement Module, domain 1    1tpgA02 A:47-91 Laminin                       CATH domains
               Pfam domains -----fn1-1tpgA02 A:6-43                    -------EGF-1tpgA01 A:51-82             --------- Pfam domains
         Sec.struct. author ...................eeeee......eeeee............eee..........eeeee.....eeee................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---FN1_2  PDB: A:4-46 UniProt: 39-81          EGF_3  PDB: A:47-85 UniProt: 82-120    -----K PROSITE (1)
                PROSITE (2) -----FN1_1  PDB: A:6-43 UniProt: 41-78     -----------------------------EGF_1       ------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------EGF_2       ------- PROSITE (3)
           Transcript 1 (1) 1.6 ---------------------------------------------Exon 1.8b  PDB: A:50-87               ---- Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.7b  PDB: A:4-50 UniProt: 39-85          ------------------------------------1.9d  Transcript 1 (2)
                 1tpg A   1 SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKSCEIDTRAT  91
                                    10        20        30        40        50        60        70        80        90 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

NMR Structure

(-) CATH Domains  (2, 2)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 2)

NMR Structure
(-)
Clan: EGF (60)

(-) Gene Ontology  (24, 24)

NMR Structure(hide GO term definitions)
Chain A   (TPA_HUMAN | P00750)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0051219    phosphoprotein binding    Interacting selectively and non-covalently with a phosphorylated protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0045861    negative regulation of proteolysis    Any process that stops, prevents, or reduces the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
    GO:0031639    plasminogen activation    The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
    GO:0048008    platelet-derived growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a platelet-derived growth factor receptor binding to one of its physiological ligands.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0001666    response to hypoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0014909    smooth muscle cell migration    The orderly movement of a smooth muscle cell from one site to another, often during the development of a multicellular organism.
cellular component
    GO:0045177    apical part of cell    The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0030141    secretory granule    A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tpg)
 
  Sites
(no "Sites" information available for 1tpg)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tpg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tpg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TPA_HUMAN | P00750
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.68
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TPA_HUMAN | P00750
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TPA_HUMAN | P007501a5h 1bda 1pk2 1pml 1rtf 1tpk 1tpm 1tpn 5brr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TPG)