1TOL - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:157
 aligned with G3P_BPM13 | P69168 from UniProtKB/Swiss-Prot  Length:424

    Alignment length:364
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378    
            G3P_BPM13    19 AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFSAGKP 382
               SCOP domains d1tola1 A:1-65 N-terminal domains of the minor coat protein g3p  ----------------------------------------------d1tola  2                               A:125-            216 T olA                                                                                                                                                                                           SCOP domains
               CATH domains 1tolA01 A:1-135,A:209-214 Phage FD Coat Protein,Membrane penetrat                                              ion do  m                              ain 1to            lA02  A:136-                     208  [cod                                                 e=3.3                                  0.1150.1 0, no name defined]                             1tolA0-- CATH domains
               Pfam domains Phage_Coat_A-1tolA02 A:1-47                    ----------------------------------------------------------------TolA-1--t------------------------------olA01 A------------:125--211   ---------------------         -------------------------------------------------     ----------------------------------        -                                   -----------     ----- Pfam domains
         Sec.struct. author ...hhhhhh...eeeee............eeee..eeeeeeeeee.......eeeeeeeeee...----------------------------------------------..hhhh--h------------------------------hhhhhhh------------hhhhh-...hhh---------------------h....eeee-------------------------------------------------ee...----------------------------------.....eee-eeee.hhhhhhhhhhhhh........hhhhhhh..-----------.eeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tol A   1 AETVESCLAKSHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIP----------------------------------------------SGADIN--N------------------------------YAGQIKS------------AIESK-FYDASS---------------------YAGKTCTLR-------------------------------------------------IKLAP----------------------------------DGMLLDIK-PEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKN-----------APLDFKPAAA 216
                                    10        20        30        40        50        60    |    -         -         -         -         - |    |131         -         -         -|     |  -       139   | | 148|        -         -  |    157|        -         -         -         -         -|   |    -         -         -       164      |173       183       193       203  |      -    |  212    
                                                                                           65                                            125  130  |                            132   138          139 143 |  149                   150     158                                               159 163                                164    171 |                               206         207         
                                                                                                                                                 131                                                     144                                                                                                                                  172

Chain A from PDB  Type:PROTEIN  Length:157
 aligned with TOLA_ECOLI | P19934 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:228
                                                                                                                                                                                                                                                          421   
                                   206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416    |   
           TOLA_ECOLI   197 AEAAEAAAAEARKKAATEAAEKAKAEAEKKAAAEKAAADKKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAKAAAEADDIFGELSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFKP---   -
               SCOP domains d1tola1 A:1-65 N-termin               al        domains of the m                          inor coat protein       g      3p  -----------d1tola2 A:125-216 TolA                                                                       SCOP domains
               CATH domains 1tolA01 A:1-135,A:209-2               14        Phage FD Coat Pr                          otein,Membrane pe      ne      trat           ion domain 1tolA02 A:136-208  [code=3.30.1150.10, no name defined]                  1tolA0-- CATH domains
               Pfam domains Phage_Coat_A-1tolA02 A:---------------1--------47               --------------------------     -----------------------------------------TolA-1tolA01 A:125-211                                                                 ----- Pfam domains
         Sec.struct. author ...hhhhhh...eeeee......---------------..-------....eeee..eeeeeee--------------------------eee.......eeeeeee------ee------e...-----------..hhhhhhhhhhhhhhhhh...hhhh....eeeeee........eeeeeee.hhhhhhhhhhhhh........hhhhhhh...eeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1tol A   1 AETVESCLAKSHTENSFTNVWKD---------------DK-------TLDRYANYEGCLWNATG--------------------------VVVCTGDETQCYGTWVP------IG------LAIP-----------SGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFKPAAA 216
                                    10        20  |      -        25       |28        38   |     -         -         -|       52      |  -   ||    - |  |    -      |128       138       148       158       168       178       188       198       208        
                                                 23              24|      26              42                         43              59     60|     62 65         125                                                                                           
                                                                  25                                                                         61

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (2, 2)

Gene Ontology (22, 25)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (G3P_BPM13 | P69168)

biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019076	viral release from host cell	The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
	GO:0019062	virion attachment to host cell	The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
	GO:0039666	virion attachment to host cell pilus	The process by which a virion attaches to a host cell by binding to a pilus on the host cell surface. Pili are retractile filaments that protrude from gram-negative bacteria. Filamentous viruses can attach to the pilus tip, whereas icosahedral viruses can attach to the pilus side.
cellular component
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019028	viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.

Chain A (TOLA_ECOLI | P19934)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0043213	bacteriocin transport	The directed movement of a bacteriocin into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Bacteriocins are a group of antibiotics produced by bacteria and are encoded by a group of naturally occurring plasmids, e.g. Col E1. Bacteriocins are toxic to bacteria closely related to the bacteriocin producing strain.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0071237	cellular response to bacteriocin	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bacteriocin stimulus. A bacteriocin is a protein substance released by certain bacteria that kills but does not lyse closely related strains of bacteria. Specific bacteriocins attach to specific receptors on cell walls and induce specific metabolic block, e.g. cessation of nucleic acid or protein synthesis of oxidative phosphorylation.
	GO:0017038	protein import	The targeting and directed movement of proteins into a cell or organelle. Not all import involves an initial targeting event.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
cellular component
	GO:0032153	cell division site	The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1tol
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	G3P_BPM13 \| P69168
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TOLA_ECOLI \| P19934
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments