Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TACHYLECTIN-2 FROM TACHYPLEUS TRIDENTATUS (JAPANESE HORSESHOE CRAB)
 
Authors :  H. -G. Beisel, S. Kawabata, S. Iwanaga, R. Huber, W. Bode
Date :  14 Dec 98  (Deposition) - 15 Dec 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Animal Lectin, Horseshoe Crab, N-Acetylglucosamine, Beta- Propeller, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. G. Beisel, S. Kawabata, S. Iwanaga, R. Huber, W. Bode
Tachylectin-2: Crystal Structure Of A Specific Glcnac/Galnac-Binding Lectin Involved In The Innate Immunity Host Defense Of The Japanese Horseshoe Crab Tachypleus Tridentatus.
Embo J. V. 18 2313 1999
PubMed-ID: 10228146  |  Reference-DOI: 10.1093/EMBOJ/18.9.2313
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (TACHYLECTIN-2)
    ChainsA
    Organism ScientificTACHYPLEUS TRIDENTATUS
    Organism Taxid6853
    Other DetailsFORMERLY NAMED L10, NOW TACHYLECTIN-2
    SynonymL10

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric/Biological Unit (1, 5)
No.NameCountTypeFull Name
1NDG5Ligand/Ion2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:36 , LYS A:37 , GLY A:38 , TRP A:40 , ASP A:71 , ASP A:73 , ASN A:74 , TRP A:75 , MET A:76 , GLN A:178 , TYR A:213 , NDG A:241 , HOH A:258BINDING SITE FOR RESIDUE NDG A 237
2AC2SOFTWARELYS A:24 , ASN A:27 , TRP A:28 , LEU A:29 , GLY A:224 , ASN A:225 , GLY A:226 , TRP A:228 , PHE A:231 , HOH A:252BINDING SITE FOR RESIDUE NDG A 238
3AC3SOFTWAREGLY A:130 , SER A:131 , GLY A:132 , TRP A:134 , ASN A:165 , ASN A:168 , TRP A:169 , LEU A:170 , HOH A:253 , HOH A:384BINDING SITE FOR RESIDUE NDG A 239
4AC4SOFTWAREGLY A:83 , ASN A:84 , GLY A:85 , TRP A:87 , ASP A:118 , ASP A:120 , ASN A:121 , TRP A:122 , ILE A:123 , HOH A:290BINDING SITE FOR RESIDUE NDG A 240
5AC5SOFTWAREGLY A:177 , GLN A:178 , GLY A:179 , TRP A:181 , ALA A:212 , ASN A:215 , TRP A:216 , LEU A:217 , NDG A:237 , HOH A:270 , HOH A:291 , HOH A:297 , HOH A:330 , HOH A:396BINDING SITE FOR RESIDUE NDG A 241

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TL2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TL2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_TAL2_TACTR_001 *I148VTAL2_TACTR  ---  ---AV129V
2UniProtVAR_TAL2_TACTR_002 *H232YTAL2_TACTR  ---  ---AY213Y
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TL2)

(-) Exons   (0, 0)

(no "Exon" information available for 1TL2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:235
 aligned with TAL2_TACTR | Q27084 from UniProtKB/Swiss-Prot  Length:255

    Alignment length:235
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250     
           TAL2_TACTR    21 GGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF 255
               SCOP domains d1tl2a_ A: Tachylectin-2                                                                                                                                                                                                                    SCOP domains
               CATH domains 1tl2A00 A:2-236 Tachylectin-2; Chain A                                                                                                                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee..eeeee.........hhhh.eeee........eeee....eeeeee..eeeeee........hhhh.eeee...hhh..eeee....eeeeee..eeeeee........hhhh.eeee...hhheeeeee....eeeeee..eeeeee........hhhh.eeee...hhheeeeee....eeeeee..eeeeee........hhhh.eeeee..hhheeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------Y----------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tl2 A   2 GGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEVGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAYDNWLARAKLIGNGGWDDFRFLFF 236
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1TL2)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (TAL2_TACTR | Q27084)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
biological process
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NDG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tl2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tl2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TAL2_TACTR | Q27084
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TAL2_TACTR | Q27084
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TAL2_TACTR | Q270843kif 3kih

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TL2)