1T27 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   THE STRUCTURE OF PITP COMPLEXED TO PHOSPHATIDYLCHOLINE

Authors :   M. D. Yoder, L. M. Thomas, J. M. Tremblay, R. L. Oliver, L. R. Yarbrough, G. M. Helmkamp Jr.

Date :   20 Apr 04 (Deposition) - 11 May 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym./Biol. Unit : A

Keywords :   Lipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. D. Yoder, L. M. Thomas, J. M. Tremblay, R. L. Oliver, L. R. Yarbrough, G. M. Helmkamp Jr.
Structure Of A Multifunctional Protein. Mammalian Phosphatidylinositol Transfer Protein Complexed With Phosphatidylcholine
J. Biol. Chem. V. 276 9246 2001
PubMed-ID: 11104777 | Reference-DOI: 10.1074/JBC.M010131200
(for further references see the PDB file header)

Molecule 1 - PHOSPHATIDYLINOSITOL TRANSFER PROTEIN ALPHA ISOFORM
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	B834(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	PITPN, PITPNA
	Organ	:	BRAIN
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	PTDINS TRANSFER PROTEIN ALPHA, PTDINSTP, PI-TP- ALPHA

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 1)

No.	Name	Count	Type	Full Name
1	PCW	1	Ligand/Ion	1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:22 , TYR A:63 , LYS A:68 , ALA A:77 , LEU A:82 , GLU A:86 , ASN A:90 , THR A:97 , ILE A:99 , ASN A:101 , TYR A:103 , MET A:104 , LYS A:195 , TRP A:203 , PHE A:213 , GLN A:217 , GLU A:218 , PHE A:222 , MET A:267 , ASP A:270 , HOH A:503 , HOH A:628	BINDING SITE FOR RESIDUE PCW A 501

(no "SS Bond" information available for 1T27)

Asymmetric/Biological Unit

No.	Residues
1	Tyr A:92	-	Pro A:93
2	Gly A:172	-	Pro A:173

(no "SAP(SNP)/Variant" information available for 1T27)

(no "PROSITE Motif" information available for 1T27)

Asymmetric/Biological Unit (11, 11)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000005368	1	ENSRNOE00000301382	chr10:62908505-62908744	240	PIPNA_RAT	1-7	7	1	A:2-7	6
1.2	ENSRNOT00000005368	2	ENSRNOE00000036186	chr10:62912614-62912644	31	PIPNA_RAT	7-17	11	1	A:7-17	11
1.3	ENSRNOT00000005368	3	ENSRNOE00000005377	chr10:62918568-62918716	149	PIPNA_RAT	18-67	50	1	A:18-67	50
1.4	ENSRNOT00000005368	4	ENSRNOE00000036270	chr10:62923824-62923915	92	PIPNA_RAT	67-98	32	1	A:67-98	32
1.5	ENSRNOT00000005368	5	ENSRNOE00000449321	chr10:62929241-62929248	8	PIPNA_RAT	98-100	3	1	A:98-100	3
1.6	ENSRNOT00000005368	6	ENSRNOE00000036332	chr10:62930193-62930267	75	PIPNA_RAT	101-125	25	1	A:101-125	25
1.7	ENSRNOT00000005368	7	ENSRNOE00000036398	chr10:62933121-62933204	84	PIPNA_RAT	126-153	28	1	A:126-153	28
1.8	ENSRNOT00000005368	8	ENSRNOE00000036510	chr10:62939297-62939374	78	PIPNA_RAT	154-179	26	1	A:154-179	26
1.9	ENSRNOT00000005368	9	ENSRNOE00000036593	chr10:62939501-62939611	111	PIPNA_RAT	180-216	37	1	A:180-216	37
1.10	ENSRNOT00000005368	10	ENSRNOE00000036701	chr10:62940320-62940442	123	PIPNA_RAT	217-257	41	1	A:217-257	41
1.11	ENSRNOT00000005368	11	ENSRNOE00000036791	chr10:62946145-62946210	66	PIPNA_RAT	258-271	14	1	A:258-270	13
1.12	ENSRNOT00000005368	12	ENSRNOE00000297107	chr10:62948248-62948856	609	PIPNA_RAT	-	0	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:269
 aligned with PIPNA_RAT | P16446 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:269
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261         
            PIPNA_RAT     2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTAD 270
               SCOP domains d1t27a_ A: Phoshatidylinositol transfer protein, PITP                                                                                                                                                                                                                         SCOP domains
               CATH domains 1t27A00 A:2-270  [code=3.30.530.20, no name defined]                                                                                                                                                                                                                          CATH domains
               Pfam domains IP_trans-1t27A01 A:2-255                                                                                                                                                                                                                                      --------------- Pfam domains
         Sec.struct. author .eeeeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeeeeeeee.....eeeeeeeeee.....hhhhhh........eeeeeeee..eeeeeee...hhh.eeeeeeeeee..............hhhhhheeeee...hhhhh.....hhhhh................hhhhhhh.......eeeeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1   ----------Exon 1.3  PDB: A:18-67 UniProt: 18-67             ------------------------------1.5Exon 1.6  PDB: A:101-125 Exon 1.7  PDB: A:126-153    Exon 1.8  PDB: A:154-179  Exon 1.9  PDB: A:180-216             Exon 1.10  PDB: A:217-257                Exon 1.11     Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2   -------------------------------------------------Exon 1.4  PDB: A:67-98          ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1t27 A   2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTAD 270
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: TBP-like (289)

Superfamily: Bet v1-like (158)

Family: Phoshatidylinositol transfer protein, PITP (4)

Protein domain: Phoshatidylinositol transfer protein, PITP (4)

Norway rat (Rattus norvegicus) [TaxId: 10116] (1)

d1t27a_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 (47)

Homologous Superfamily: [code=3.30.530.20, no name defined] (47)

Norway rat (Rattus norvegicus) (2)

1t27A00

A:2-270

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Bet_V_1_like (93)

Family: IP_trans (3)

Rattus norvegicus (Rat) (1)

IP_trans-1t27A01

A:2-255

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PIPNA_RAT | P16446)

molecular function
	GO:0000062	fatty-acyl-CoA binding	Interacting selectively and non-covalently with acyl-CoA, any derivative of coenzyme A in which the sulfhydryl group is in thiolester linkage with a fatty acyl group.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0035091	phosphatidylinositol binding	Interacting selectively and non-covalently with any inositol-containing glycerophospholipid, i.e. phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0008526	phosphatidylinositol transporter activity	Enables the directed movement of phosphatidylinositol into, out of or within a cell, or between cells. Phosphatidylinositol refers to any glycophospholipids with its sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0005543	phospholipid binding	Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester.
	GO:0070540	stearic acid binding	Interacting selectively and non-covalently with stearic acid, the 18-carbon saturated fatty acid octadecanoic acid.
biological process
	GO:0015914	phospholipid transport	The directed movement of phospholipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Phospholipids are any lipids containing phosphoric acid as a mono- or diester.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PCW	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:172 - Pro A:173	[ RasMol ]
		Tyr A:92 - Pro A:93	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1t27
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PIPNA_RAT \| P16446
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PIPNA_RAT \| P16446
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1T27)

(no "Related Entries Specified in the PDB File" available for 1T27)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (11, 11)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File