|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1T0Y) |
(no "Site" information available for 1T0Y) |
(no "SS Bond" information available for 1T0Y) |
(no "Cis Peptide Bond" information available for 1T0Y) |
(no "SAP(SNP)/Variant" information available for 1T0Y) |
(no "PROSITE Motif" information available for 1T0Y) |
(no "Exon" information available for 1T0Y) |
NMR StructureChain A from PDB Type:PROTEIN Length:90 aligned with TBCB_CAEEL | Q20728 from UniProtKB/Swiss-Prot Length:229 Alignment length:90 10 20 30 40 50 60 70 80 90 TBCB_CAEEL 1 MTEVYDLEITTNATDFPMEKKYPAGMSLNDLKKKLELVVGTTVDSMRIQLFDGDDQLKGELTDGAKSLKDLGVRDGYRIHAVDVTGGNED 90 SCOP domains d1t0ya_ A: Ubiquitin-like domain of tubulin folding cofactor B SCOP domains CATH domains 1t0yA00 A:1-90 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1t0y A 1 MTEVYDLEITTNATDFPMEKKYPAGMSLNDLKKKLELVVGTTVDSMRIQLFDGDDQLKGELTDGAKSLKDLGVRDGYRIHAVDVTGGNED 90 10 20 30 40 50 60 70 80 90
|
NMR Structure |
NMR Structure
|
(no "Pfam Domain" information available for 1T0Y) |
NMR Structure(hide GO term definitions) Chain A (TBCB_CAEEL | Q20728)
|
|
|
|
|
|
|