1SZZ - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PEPTIDE DEFORMYLASE FROM LEPTOSPIRA INTERROGANS COMPLEXED WITH INHIBITOR ACTINONIN

Authors :   Z. Zhou, X. Song, Y. Li, W. Gong

Date :   06 Apr 04 (Deposition) - 16 Aug 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.30

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,E  (1x)
Biol. Unit 3: D,H  (1x)
Biol. Unit 4: F,G  (1x)

Keywords :   Half-Open Conformation, Bb2 Complexed, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Z. Zhou, X. Song, W. Gong
Novel Conformational States Of Peptide Deformylase From Pathogenic Bacterium Leptospira Interrogans: Implications For Population Shift
J. Biol. Chem. V. 280 42391 2005
PubMed-ID: 16239225 | Reference-DOI: 10.1074/JBC.M506370200
(for further references see the PDB file header)

Molecule 1 - PEPTIDE DEFORMYLASE
	Chains	:	A, B, C, D, E, F, G, H
	EC Number	:	3.5.1.88
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PET22B
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Gene	:	DEF
	Organism Scientific	:	LEPTOSPIRA INTERROGANS
	Organism Taxid	:	173
	Synonym	:	LIPDF, PDF, POLYPEPTIDE DEFORMYLASE

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B			E
Biological Unit 3 (1x)	:				D				H
Biological Unit 4 (1x)	:						F	G

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 16)

No.	Name	Count	Type	Full Name
1	BB2	8	Ligand/Ion	ACTINONIN
2	ZN	8	Ligand/Ion	ZINC ION

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	BB2	2	Ligand/Ion	ACTINONIN
2	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	BB2	2	Ligand/Ion	ACTINONIN
2	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	BB2	2	Ligand/Ion	ACTINONIN
2	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 4 (1, 2)

No.	Name	Count	Type	Full Name
1	BB2	2	Ligand/Ion	ACTINONIN
2	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (16, 16)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLN A:53 , CYS A:101 , HIS A:143 , HIS A:147 , BB2 A:513	BINDING SITE FOR RESIDUE ZN A 716
02	AC2	SOFTWARE	GLN B:53 , CYS B:101 , HIS B:143 , HIS B:147 , BB2 B:514	BINDING SITE FOR RESIDUE ZN B 717
03	AC3	SOFTWARE	GLN C:53 , CYS C:101 , HIS C:143 , HIS C:147 , BB2 C:515	BINDING SITE FOR RESIDUE ZN C 718
04	AC4	SOFTWARE	GLN D:53 , CYS D:101 , HIS D:143 , HIS D:147 , BB2 D:516	BINDING SITE FOR RESIDUE ZN D 719
05	AC5	SOFTWARE	GLN E:53 , CYS E:101 , HIS E:143 , HIS E:147 , BB2 E:517	BINDING SITE FOR RESIDUE ZN E 720
06	AC6	SOFTWARE	GLN F:53 , CYS F:101 , HIS F:143 , HIS F:147 , BB2 F:518	BINDING SITE FOR RESIDUE ZN F 721
07	AC7	SOFTWARE	GLN G:53 , CYS G:101 , HIS G:143 , HIS G:147 , BB2 G:519	BINDING SITE FOR RESIDUE ZN G 722
08	AC8	SOFTWARE	GLN H:53 , CYS H:101 , HIS H:143 , HIS H:147 , BB2 H:520	BINDING SITE FOR RESIDUE ZN H 723
09	AC9	SOFTWARE	GLY A:46 , VAL A:47 , GLY A:48 , GLN A:53 , TRP A:98 , GLY A:100 , CYS A:101 , LEU A:102 , TYR A:136 , ILE A:139 , VAL A:140 , HIS A:143 , GLU A:144 , HIS A:147 , ZN A:716	BINDING SITE FOR RESIDUE BB2 A 513
10	BC1	SOFTWARE	GLY B:46 , VAL B:47 , GLY B:48 , GLN B:53 , TYR B:71 , PHE B:97 , TRP B:98 , GLY B:100 , CYS B:101 , LEU B:102 , TYR B:136 , ILE B:139 , VAL B:140 , HIS B:143 , GLU B:144 , HIS B:147 , ZN B:717	BINDING SITE FOR RESIDUE BB2 B 514
11	BC2	SOFTWARE	GLY C:46 , VAL C:47 , GLY C:48 , GLN C:53 , TYR C:71 , TRP C:98 , GLU C:99 , GLY C:100 , CYS C:101 , LEU C:102 , TYR C:136 , ILE C:139 , HIS C:143 , GLU C:144 , HIS C:147 , ZN C:718	BINDING SITE FOR RESIDUE BB2 C 515
12	BC3	SOFTWARE	GLY D:46 , VAL D:47 , GLY D:48 , GLN D:53 , GLU D:69 , THR D:74 , TRP D:98 , GLU D:99 , GLY D:100 , CYS D:101 , LEU D:102 , TYR D:136 , VAL D:140 , HIS D:143 , GLU D:144 , HIS D:147 , ZN D:719	BINDING SITE FOR RESIDUE BB2 D 516
13	BC4	SOFTWARE	GLY E:46 , VAL E:47 , GLY E:48 , GLN E:53 , TRP E:98 , GLU E:99 , GLY E:100 , CYS E:101 , LEU E:102 , ILE E:139 , HIS E:143 , GLU E:144 , HIS E:147 , ZN E:720	BINDING SITE FOR RESIDUE BB2 E 517
14	BC5	SOFTWARE	GLY F:46 , VAL F:47 , GLY F:48 , GLN F:53 , TRP F:98 , GLY F:100 , CYS F:101 , LEU F:102 , TYR F:136 , HIS F:143 , GLU F:144 , HIS F:147 , ZN F:721	BINDING SITE FOR RESIDUE BB2 F 518
15	BC6	SOFTWARE	VAL G:47 , GLY G:48 , GLN G:53 , PHE G:97 , TRP G:98 , GLU G:99 , GLY G:100 , CYS G:101 , LEU G:102 , ILE G:139 , VAL G:140 , HIS G:143 , GLU G:144 , HIS G:147 , ZN G:722	BINDING SITE FOR RESIDUE BB2 G 519
16	BC7	SOFTWARE	GLY H:46 , VAL H:47 , GLY H:48 , GLN H:53 , TRP H:98 , GLY H:100 , CYS H:101 , LEU H:102 , ARG H:108 , TYR H:136 , VAL H:140 , HIS H:143 , GLU H:144 , HIS H:147 , ZN H:723	BINDING SITE FOR RESIDUE BB2 H 520

(no "SS Bond" information available for 1SZZ)

(no "Cis Peptide Bond" information available for 1SZZ)

(no "SAP(SNP)/Variant" information available for 1SZZ)

(no "PROSITE Motif" information available for 1SZZ)

(no "Exon" information available for 1SZZ)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzA00 A:1-171 Peptide Deformylase                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeee................eeee..eeee....ee..ee.......eeee..ee.eeeee..........eeeehhhhhhhhhhhhhhh..hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz A   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain B from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzB00 B:1-171 Peptide Deformylase                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeee................eeeeeeeeee....ee..ee.......eeee..ee.eeeeeee........eeeehhhhhhhhhhhhhhh..hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz B   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain C from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzC00 C:1-171 Peptide Deformylase                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeeeee...........eeeeeee..eeee....ee..ee.......eeee..ee.eeeee..........eeeehhhhhhhhhhhhhhh..hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz C   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain D from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzD00 D:1-171 Peptide Deformylase                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeee................eeee..eeee....ee..eeee..eeeeeee..ee.eeeee..........eeeehhhhhhhhhhhhhhh..hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz D   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain E from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzE00 E:1-171 Peptide Deformylase                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeee................eeeeeeeeee....ee..eeee..eeeeeee..ee.eeeeeee........eeeehhhhhhhhhhhhhh...hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz E   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain F from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzF00 F:1-171 Peptide Deformylase                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeee................eeeeeeeeee....ee..ee.......eeee..ee.eeeeeee........eeeehhhhhhhhhhhhhhh..hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz F   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain G from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzG00 G:1-171 Peptide Deformylase                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeee................eeeeeeeeee....ee..eeee..eeeeeee..ee.eeeeeee........eeeehhhhhhhhhhhhhhh..hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz G   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain H from PDB  Type:PROTEIN  Length:171
 aligned with DEF_LEPIN | Q93LE9 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171 
            DEF_LEPIN     2 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 172
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1szzH00 H:1-171 Peptide Deformylase                                                                                                                                         CATH domains
           Pfam domains (1) -Pep_deformylase-1szzH01 H:2-163                                                                                                                                   -------- Pfam domains (1)
           Pfam domains (2) -Pep_deformylase-1szzH02 H:2-163                                                                                                                                   -------- Pfam domains (2)
           Pfam domains (3) -Pep_deformylase-1szzH03 H:2-163                                                                                                                                   -------- Pfam domains (3)
           Pfam domains (4) -Pep_deformylase-1szzH04 H:2-163                                                                                                                                   -------- Pfam domains (4)
           Pfam domains (5) -Pep_deformylase-1szzH05 H:2-163                                                                                                                                   -------- Pfam domains (5)
           Pfam domains (6) -Pep_deformylase-1szzH06 H:2-163                                                                                                                                   -------- Pfam domains (6)
           Pfam domains (7) -Pep_deformylase-1szzH07 H:2-163                                                                                                                                   -------- Pfam domains (7)
           Pfam domains (8) -Pep_deformylase-1szzH08 H:2-163                                                                                                                                   -------- Pfam domains (8)
         Sec.struct. author .........hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eee.hhhh....eeee................eeee..eeee....ee..ee.......eeee..ee.eeeee..........eeeehhhhhhhhhhhhhhh..hhhhhh.....eeehhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1szz H   1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFTTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPERIILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDS 171
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1SZZ)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Peptide Deformylase (68)

Homologous Superfamily: Peptide Deformylase (68)

Leptospira interrogans. Organism_taxid: 173. (2)

1a	1szzA00	A:1-171
1b	1szzB00	B:1-171
1c	1szzC00	C:1-171
1d	1szzD00	D:1-171
1e	1szzE00	E:1-171
1f	1szzF00	F:1-171
1g	1szzG00	G:1-171
1h	1szzH00	H:1-171

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Pep_deformylase] (48)

Family: Pep_deformylase (48)

Leptospira interrogans (5)

1a	Pep_deformylase-1szzH01	H:2-163
1b	Pep_deformylase-1szzH02	H:2-163
1c	Pep_deformylase-1szzH03	H:2-163
1d	Pep_deformylase-1szzH04	H:2-163
1e	Pep_deformylase-1szzH05	H:2-163
1f	Pep_deformylase-1szzH06	H:2-163
1g	Pep_deformylase-1szzH07	H:2-163
1h	Pep_deformylase-1szzH08	H:2-163

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H (DEF_LEPIN | Q93LE9)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0042586	peptide deformylase activity	Catalysis of the reaction: formyl-L-methionyl peptide + H2O = formate + methionyl peptide.
biological process
	GO:0031365	N-terminal protein amino acid modification	The alteration of the N-terminal amino acid residue in a protein.
	GO:0043686	co-translational protein modification	The process of covalently altering one or more amino acids in a protein after translation has begun but before the protein has been released from the ribosome.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BB2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1szz)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1szz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DEF_LEPIN \| Q93LE9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.5.1.88
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DEF_LEPIN \| Q93LE9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DEF_LEPIN \| Q93LE9	:	1sv2 1vev 1vey 1vez 1y6h

(no "Related Entries Specified in the PDB File" available for 1SZZ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 16)

Sites (16, 16)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 8)

Pfam Domains (1, 8)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File