Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF AMBYSTOMA TIGRINUM CONE ARRESTIN
 
Authors :  R. B. Sutton, J. Navarro
Date :  26 Mar 04  (Deposition) - 23 Aug 05  (Release) - 09 Jun 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.38
Chains :  Asym./Biol. Unit :  A
Keywords :  Sensory Transduction, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. B. Sutton, S. A. Vishnivetskiy, J. Robert, S. M. Hanson, D. Raman, B. E. Knox, M. Kono, J. Navarro, V. V. Gurevich
Crystal Structure Of Cone Arrestin At 2. 3A: Evolution Of Receptor Specificity.
J. Mol. Biol. V. 354 1069 2005
PubMed-ID: 16289201  |  Reference-DOI: 10.1016/J.JMB.2005.10.023
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CONE ARRESTIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PTRCHISB
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: ARR2
    Organism Common: TIGER SALAMANDER
    Organism Scientific: AMBYSTOMA TIGRINUM
    Organism Taxid: 8305

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SUJ)

(-) Sites  (0, 0)

(no "Site" information available for 1SUJ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SUJ)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Tyr A:86 -Pro A:87

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SUJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SUJ)

(-) Exons   (0, 0)

(no "Exon" information available for 1SUJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:363
 aligned with Q9PTE7_AMBTI | Q9PTE7 from UniProtKB/TrEMBL  Length:392

    Alignment length:370
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374
         Q9PTE7_AMBTI     5 SKVYKKTCPNAKLSIYLGKRDFVDHVEHVEPVDGVVLIDPEYLKDRKVFVTLTCAFRYGRDDLDLIGMSFRKDLYSLATQVYPPETKEPLTPLQEKLMKKLGAHAYPFCFKMGTNLPCSVTLQPGPDDTGKSCGVDFEVKAFCAENLEEKIHKRNSVQLVIRKVQFAPANLGVAPKTEITRQFMLSDRPLHLEASLDKEIYYHGEPINVNVKINNTTGKIVKKIKIIVEQVTDVVLFSLDKYVKTVCAEETNDTVAANSTLSKTFSVTPMLANNREKRGLALDGKLKHEDTNLASTTVIRPGMDKEVLGILVSYKVKVHLVVARGGILGDLTSSDVAVELPLTLMHPKPSDDKPRSEEDIIIEEFARQKL 374
               SCOP domains d1suja1 A:5-173 automated matches                                                                                                                                        d1suja2 A:174-374 automated matches                                                                                                                                                                       SCOP domains
               CATH domains -1sujA01 A:6-176  [code=2.60.40.840, no name defined]                                                                                                                       1sujA02 A:177-355  [code=2.60.40.640, no name defined]                                                                                                                             ------------------- CATH domains
               Pfam domains ------------Arrestin_N-1sujA02 A:17-171                                                                                                                                ------------------Arrestin_C-1sujA01 A:190-353                                                                                                                                        --------------------- Pfam domains
         Sec.struct. author .eeeeee.....eeeee...eeee.......eeeeeee........eeeeeeeeeeeee.........eeeeeeeeeeeeee........hhhhhhhhhhhh..eeeeee.........eee..........eeeeeeeeeeee.......hhh.eeeeeeeeee............eeeeeeee..eeeeeeeee...eee....eeeeeeeee....eeeeeeeeeeeeeee......eeeeeeeeee........eeeeeeeee..hhhhh.............................hhhhh.eeeeeeeeeeeeee..........eeeeeeeeeeee......-------..eeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1suj A   5 SKVYKKTCPNAKLSIYLGKRDFVDHVEHVEPVDGVVLIDPEYLKDRKVFVTLTCAFRYGRDDLDLIGMSFRKDLYSLATQVYPPETKEPLTPLQEKLMKKLGAHAYPFCFKMGTNLPCSVTLQPGPDDTGKSCGVDFEVKAFCAENLEEKIHKRNSVQLVIRKVQFAPANLGVAPKTEITRQFMLSDRPLHLEASLDKEIYYHGEPINVNVKINNTTGKIVKKIKIIVEQVTDVVLFSLDKYVKTVCAEETNDTVAANSTLSKTFSVTPMLANNREKRGLALDGKLKHEDTNLASTTVIRPGMDKEVLGILVSYKVKVHLVVARGGILGDLTSSDVAVELPLTLMHPKPSD-------DIIIEEFARQKL 374
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354|      364       374
                                                                                                                                                                                                                                                                                                                                                                                        355     363
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Clan: Arrestin_N-like (9)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q9PTE7_AMBTI | Q9PTE7)
biological process
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1suj)
 
  Sites
(no "Sites" information available for 1suj)
 
  Cis Peptide Bonds
    Tyr A:86 - Pro A:87   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1suj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9PTE7_AMBTI | Q9PTE7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9PTE7_AMBTI | Q9PTE7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SUJ)

(-) Related Entries Specified in the PDB File

1cf1 X-RAY CRYSTAL STRUCTURE OF BOVINE ROD ARRESTIN