|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1SO9) |
Sites (0, 0)| (no "Site" information available for 1SO9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1SO9) |
Cis Peptide Bonds (1, 1)
NMR Structure
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SO9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1SO9) |
Exons (0, 0)| (no "Exon" information available for 1SO9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:131 aligned with COXZ_RHIME | Q92RG6 from UniProtKB/Swiss-Prot Length:198 Alignment length:131 64 74 84 94 104 114 124 134 144 154 164 174 184 COXZ_RHIME 55 VEQASDLILDEKIKVTFDANVAAGLPWEFVPVQRDIDVRIGETVQIMYRAKNLASTPTTGQATFNVTPMAAGAYFNKVQCFCFTETTLEPGEEMEMPVVFFVDPEIVKPVETQGIKTLTLSYTFYPREPSK 185 SCOP domains d1so9a_ A: Cytochrome C oxidase assembly protein CtaG SCOP domains CATH domains 1so9A00 A:21-151 Ctag/Cox11 (Pfam 04442) CATH domains Pfam domains CtaG_Cox11-1so9A01 A:21-147 ---- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1so9 A 21 VEQASDLILDEKIKVTFDANVAAGLPWEFVPVQRDIDVRIGETVQIMYRAKNLASTPTTGQATFNVTPMAAGAYFNKVQCFCFTETTLEPGEEMEMPVVFFVDPEIVKPVETQGIKTLTLSYTFYPREPSK 151 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (COXZ_RHIME | Q92RG6)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|