Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF APOCOX11
 
Authors :  L. Banci, I. Bertini, F. Cantini, S. Ciofi-Baffoni, L. Gonnelli, S. Mangani
Date :  16 Mar 04  (Deposition) - 10 Aug 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Immunoglobulin-Like Fold, Copper Protein, Cytochrome C Oxidase Assembly, Metal Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Banci, I. Bertini, F. Cantini, S. Ciofi-Baffoni, L. Gonnelli, S. Mangani
Solution Structure Of Cox11, A Novel Type Of {Beta}-Immunoglobulin-Like Fold Involved In Cub Site Formation Of Cytochrome C Oxidase.
J. Biol. Chem. V. 279 34833 2004
PubMed-ID: 15181013  |  Reference-DOI: 10.1074/JBC.M403655200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C OXIDASE ASSEMBLY PROTEIN CTAG
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET21A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: C-TERMINAL SOLUBLE DOMAIN
    Gene: CTAG, R00908, SMC00012
    Organism Scientific: SINORHIZOBIUM MELILOTI
    Organism Taxid: 382
    Synonym: COX11

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SP0)

(-) Sites  (0, 0)

(no "Site" information available for 1SP0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SP0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SP0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SP0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SP0)

(-) Exons   (0, 0)

(no "Exon" information available for 1SP0)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:131
 aligned with COXZ_RHIME | Q92RG6 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:131
                                    64        74        84        94       104       114       124       134       144       154       164       174       184 
           COXZ_RHIME    55 VEQASDLILDEKIKVTFDANVAAGLPWEFVPVQRDIDVRIGETVQIMYRAKNLASTPTTGQATFNVTPMAAGAYFNKVQCFCFTETTLEPGEEMEMPVVFFVDPEIVKPVETQGIKTLTLSYTFYPREPSK 185
               SCOP domains d1sp0a_ A: Cytochrome C oxidase assembly protein CtaG                                                                               SCOP domains
               CATH domains 1sp0A00 A:21-151 Ctag/Cox11 (Pfam 04442)                                                                                            CATH domains
               Pfam domains CtaG_Cox11-1sp0A01 A:21-147                                                                                                    ---- Pfam domains
         Sec.struct. author ...........eeeeeeeeee.....eeee....eeeee....eeeeeeeee.....ee...eee.........eee.........ee....eeeeeeeeee.hhhhh.........eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sp0 A  21 VEQASDLILDEKIKVTFDANVAAGLPWEFVPVQRDIDVRIGETVQIMYRAKNLASTPTTGQATFNVTPMAAGAYFNKVQCFCFTETTLEPGEEMEMPVVFFVDPEIVKPVETQGIKTLTLSYTFYPREPSK 151
                                    30        40        50        60        70        80        90       100       110       120       130       140       150
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: CtaG_Cox11] (2)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (COXZ_RHIME | Q92RG6)
molecular function
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
biological process
    GO:0008535    respiratory chain complex IV assembly    The aggregation, arrangement and bonding together of a set of components to form respiratory chain complex IV (also known as cytochrome c oxidase), the terminal member of the respiratory chain of the mitochondrion and some aerobic bacteria. Cytochrome c oxidases are multi-subunit enzymes containing from 13 subunits in the mammalian mitochondrial form to 3-4 subunits in the bacterial forms.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sp0)
 
  Sites
(no "Sites" information available for 1sp0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sp0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sp0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COXZ_RHIME | Q92RG6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COXZ_RHIME | Q92RG6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COXZ_RHIME | Q92RG6: 1so9

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SP0)