Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE RECOMBINANT PRONAPIN PRECURSOR, BNIB.
 
Authors :  D. Pantoja-Uceda, O. Palomares, M. Bruix, M. Villalba, R. Rodriguez, M J. Santoro
Date :  08 Mar 04  (Deposition) - 01 Feb 05  (Release) - 01 May 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (19x)
NMR Structure *:  A  (1x)
Keywords :  All Alpha-Helix, Right-Handed Superhelix, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Pantoja-Uceda, O. Palomares, M. Bruix, M. Villalba, R. Rodriguez, M. Rico, J. Santoro
Solution Structure And Stability Against Digestion Of Rprobnib, A Recombinant 2S Albumin From Rapeseed: Relationship To Its Allergenic Properties.
Biochemistry V. 43 16036 2004
PubMed-ID: 15609998  |  Reference-DOI: 10.1021/BI048069X

(-) Compounds

Molecule 1 - RECOMBINANT IB PRONAPIN
    Chains: A
    Engineered: YES
    Expression System: PICHIA PASTORIS
    Expression System Plasmid: PPIC9
    Expression System Strain: GS115 HIS4
    Expression System Taxid: 4922
    Expression System Vector Type: PLASMID
    Organism Common: RAPE
    Organism Scientific: BRASSICA NAPUS
    Organism Taxid: 3708

 Structural Features

(-) Chains, Units

  1
NMR Structure (19x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SM7)

(-) Sites  (0, 0)

(no "Site" information available for 1SM7)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:5 -A:59
2A:18 -A:48
3A:49 -A:96
4A:61 -A:104

(-) Cis Peptide Bonds  (1, 19)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19Cys A:61 -Pro A:62

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SM7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SM7)

(-) Exons   (0, 0)

(no "Exon" information available for 1SM7)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:109
 aligned with Q8GT96_BRANA | Q8GT96 from UniProtKB/TrEMBL  Length:109

    Alignment length:109
                                    10        20        30        40        50        60        70        80        90       100         
         Q8GT96_BRANA     1 QPQKCQREFQQEQHLRACQQWIRQQLAGSPFSENQWGPQQGPSLREQCCNELYQEDQVCVCPTLKQAAKSVRVQGQHGPFQSTRIYQIAKNLPNVCNMKQIGTCPFIAI 109
               SCOP domains ------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1sm7A00 A:1-109 Bifunctional Trypsin/Alpha-Amylase Inhibitor                                                  CATH domains
               Pfam domains ----Tryp_alpha_amyl-1sm7A01 A:5-104                                                                     ----- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh...hhhhhhhhhh.................hhhhhhhhh...hhhhhh..hhhhhhh.........hhhhhhhhh..hhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 1sm7 A   1 QPQKCQREFQQEQHLRACQQWIRQQLAGSPFSENQWGPQQGPSLREQCCNELYQEDQVCVCPTLKQAAKSVRVQGQHGPFQSTRIYQIAKNLPNVCNMKQIGTCPFIAI 109
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1SM7)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Prolamin (17)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (Q8GT96_BRANA | Q8GT96)
molecular function
    GO:0045735    nutrient reservoir activity    Functions in the storage of nutritious substrates.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sm7)
 
  Sites
(no "Sites" information available for 1sm7)
 
  Cis Peptide Bonds
    Cys A:61 - Pro A:62   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sm7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8GT96_BRANA | Q8GT96
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8GT96_BRANA | Q8GT96
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SM7)

(-) Related Entries Specified in the PDB File

1pnb