|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1PNB) |
(no "Site" information available for 1PNB) |
NMR Structure
|
NMR Structure
|
NMR Structure (1, 1)
|
(no "PROSITE Motif" information available for 1PNB) |
(no "Exon" information available for 1PNB) |
NMR StructureChain A from PDB Type:PROTEIN Length:31 aligned with 2SSI_BRANA | P24565 from UniProtKB/Swiss-Prot Length:110 Alignment length:31 10 20 30 2SSI_BRANA 1 QPQKCQREFQQEQHLRACQQWIRQQLAGSPF 31 SCOP domains d1pnb.1 A:,B: Napin BNIb SCOP domains CATH domains ------------------------------- CATH domains Pfam domains ------------------------------- Pfam domains SAPs(SNPs) ------------------------------- SAPs(SNPs) PROSITE ------------------------------- PROSITE Transcript ------------------------------- Transcript 1pnb A 1 QPQKCQREFQQEQHLRACQQWIRQQLAGSPF 31 10 20 30 Chain B from PDB Type:PROTEIN Length:75 aligned with 2SSI_BRANA | P24565 from UniProtKB/Swiss-Prot Length:110 Alignment length:75 41 51 61 71 81 91 101 2SSI_BRANA 32 QSGPQEGPWLREQCCNELYQEDQVCVCPTLKQAAKSVRVQGQHGPFQSTRIYQIAKNLPNVCNMKQIGTCPFIAI 106 SCOP domains d1pnb.1 A:,B: Napin BNIb SCOP domains CATH domains 1pnbB00 B:1-75 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains --------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----Q--------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------- Transcript 1pnb B 1 QSGPQQGPWLREQCCNELYQEDQVCVCPTLKQAAKSVRVQGQHGPFQSTRIYQIAKNLPNVCNMKQIGTCPFIAI 75 10 20 30 40 50 60 70
|
NMR Structure
|
NMR Structure |
(no "Pfam Domain" information available for 1PNB) |
NMR Structure(hide GO term definitions) Chain A,B (2SSI_BRANA | P24565)
|
|
|
|
|
|
|