|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1S6L) |
Sites (0, 0)| (no "Site" information available for 1S6L) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1S6L) |
Cis Peptide Bonds (1, 20)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1S6L) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1S6L) |
Exons (0, 0)| (no "Exon" information available for 1S6L) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:192 aligned with MERB_ECOLX | P77072 from UniProtKB/Swiss-Prot Length:212 Alignment length:192 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 MERB_ECOLX 21 ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP 212 SCOP domains d1s6la1 A:21-80 Alkylmercury lyase MerB d1s6la2 A:81-212 Alkylmercury lyase MerB SCOP domains CATH domains ----1s6lA01 A:25-76 ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains HTH_15-1s6lA01 A:21-75 MerB-1s6lA02 A:76-204 -------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1s6l A 21 ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP 212 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210
|
||||||||||||||||||||
SCOP Domains (2, 2)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (2, 2)| NMR Structure |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (MERB_ECOLX | P77072)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|