Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL AND MUTATIONAL CHARACTERIZATION OF L-CARNITINE BINDING TO HUMAN CARNITINE ACETYLTRANSFERASE
 
Authors :  L. Govindasamy, T. Kukar, W. Lian, B. Pedersen, Y. Gu, M. Agbandje- Mckenna, S. Jin, R. Mckenna, D. Wu
Date :  21 Jan 04  (Deposition) - 03 Feb 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Carnitine Acetyltransferase, Binary Complex, X-Ray Structure, Steady-State Enzyme Kinetics, Substrate Binding Site (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Govindasamy, T. Kukar, W. Lian, B. Pedersen, Y. Gu, M. Agbandje-Mckenna, S. Jin, R. Mckenna, D. Wu
Structural And Mutational Characterization Of L-Carnitine Binding To Human Carnitine Acetyltransferase.
J. Struct. Biol. V. 146 416 2004
PubMed-ID: 15099582  |  Reference-DOI: 10.1016/J.JSB.2004.01.011
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CARNITINE ACETYLTRANSFERASE ISOFORM 2
    ChainsA
    EC Number2.3.1.7
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
11521Ligand/IonCARNITINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:81 , HIS A:322 , GLU A:326 , TYR A:431 , SER A:433 , THR A:444 , SER A:531 , PHE A:545 , HOH A:638BINDING SITE FOR RESIDUE 152 A 617

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1S5O)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S5O)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_047780L372MCACP_HUMANPolymorphism3118635AM351M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ACYLTRANSF_C_1PS00439 Acyltransferases ChoActase / COT / CPT family signature 1.CACP_HUMAN35-50  1A:14-29
2ACYLTRANSF_C_2PS00440 Acyltransferases ChoActase / COT / CPT family signature 2.CACP_HUMAN321-348  1A:300-327

(-) Exons   (13, 13)

Asymmetric/Biological Unit (13, 13)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000003180802aENSE00002198585chr9:131873083-131872762322CACP_HUMAN1-990--
1.6cENST000003180806cENSE00001643423chr9:131870356-131870093264CACP_HUMAN10-97881A:9-7668
1.7bENST000003180807bENSE00001742690chr9:131866585-131866467119CACP_HUMAN98-137401A:77-11640
1.8ENST000003180808ENSE00001673785chr9:131865345-13186529254CACP_HUMAN137-155191A:116-13419
1.9bENST000003180809bENSE00001752446chr9:131864844-131864679166CACP_HUMAN155-210561A:134-18956
1.10bENST0000031808010bENSE00001739720chr9:131864336-131864162175CACP_HUMAN211-269591A:190-24859
1.11bENST0000031808011bENSE00001626328chr9:131862968-131862790179CACP_HUMAN269-328601A:248-30760
1.12ENST0000031808012ENSE00001715827chr9:131862245-131862145101CACP_HUMAN329-362341A:308-34134
1.13ENST0000031808013ENSE00001796247chr9:131860929-131860810120CACP_HUMAN362-402411A:341-38141
1.14ENST0000031808014ENSE00001603258chr9:131860650-131860528123CACP_HUMAN402-443421A:381-42242
1.15aENST0000031808015aENSE00001716530chr9:131860427-131860292136CACP_HUMAN443-488461A:422-46746
1.16ENST0000031808016ENSE00001754439chr9:131859591-13185952963CACP_HUMAN489-509211A:468-48821
1.17cENST0000031808017cENSE00001720684chr9:131858414-131858277138CACP_HUMAN510-555461A:489-53446
1.18dENST0000031808018dENSE00001821873chr9:131857891-131857089803CACP_HUMAN556-626711A:535-59965

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:591
 aligned with CACP_HUMAN | P43155 from UniProtKB/Swiss-Prot  Length:626

    Alignment length:591
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619 
           CACP_HUMAN    30 AHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS 620
               SCOP domains d1s5oa1 A:9-385 Carnitine acetyltransferase                                                                                                                                                                                                                                                                                                                                              d1s5oa2 A:386-599 Carnitine acetyltransferase                                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhh.............eee.......hhhhhhhhhhhhhhhhhhhhhhhhhh.....ee..ee..hhhhhh...eeee......eeee.........eeeeee..eeeeee.........hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..eeeee.........hhhhhhhhhhhhh....hhhhh......eeeeee....eeeee.....hhhhhhhhhhhhhhhhh...............eee....hhhhhhhhhhhhhhhhhhhhheeeeeeee....hhhhhhh..hhhhhhhhhhhhhhhhhhh....eeeeee........eeee...hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..eeeee.......eee........eeeeeee....eeeeeeee......hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----ACYLTRANSF_C_1  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACYLTRANSF_C_2              -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6c  PDB: A:9-76 UniProt: 10-97 [INCOMPLETE]                  Exon 1.7b  PDB: A:77-116 UniProt: 98-137-----------------Exon 1.9b  PDB: A:134-189 UniProt: 155-210              Exon 1.10b  PDB: A:190-248 UniProt: 211-269                -----------------------------------------------------------Exon 1.12  PDB: A:308-341         ---------------------------------------Exon 1.14  PDB: A:381-422 UniProt: 402-443---------------------------------------------Exon 1.16            Exon 1.17c  PDB: A:489-534 UniProt: 510-555   Exon 1.18d  PDB: A:535-599 UniProt: 556-626 [INCOMPLETE]          Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------Exon 1.8           -----------------------------------------------------------------------------------------------------------------Exon 1.11b  PDB: A:248-307 UniProt: 269-328                 ---------------------------------Exon 1.13  PDB: A:341-381                ----------------------------------------Exon 1.15a  PDB: A:422-467 UniProt: 443-488   ------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1s5o A   9 HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS 599
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1S5O)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1S5O)

(-) Gene Ontology  (15, 15)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CACP_HUMAN | P43155)
molecular function
    GO:0004092    carnitine O-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + carnitine = (R)-O-acetylcarnitine + CoA.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0019254    carnitine metabolic process, CoA-linked    The chemical reactions and pathways involving carnitine, where metabolism is linked to CoA.
    GO:0033540    fatty acid beta-oxidation using acyl-CoA oxidase    A fatty acid beta-oxidation pathway in which the initial step, which converts an acyl-CoA to a trans-2-enoyl-CoA, is catalyzed by acyl-CoA oxidase; the electrons removed by oxidation pass directly to oxygen and produce hydrogen peroxide, which is cleaved by peroxisomal catalases. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and ends when only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005743    mitochondrial inner membrane    The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005782    peroxisomal matrix    The volume contained within the membranes of a peroxisome; in many cells the matrix contains a crystalloid core largely composed of urate oxidase.
    GO:0005777    peroxisome    A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    152  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s5o)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s5o
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CACP_HUMAN | P43155
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CACP_HUMAN | P43155
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CACP_HUMAN | P431551nm8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1S5O)