|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1RXE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1RXE) |
SAPs(SNPs)/Variants (12, 12)
Asymmetric/Biological Unit (12, 12)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1RXE) |
Exons (0, 0)| (no "Exon" information available for 1RXE) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:131 aligned with ARSC_STAAU | P0A006 from UniProtKB/Swiss-Prot Length:131 Alignment length:131 10 20 30 40 50 60 70 80 90 100 110 120 130 ARSC_STAAU 1 MDKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR 131 SCOP domains d1rxea_ A: Arsenate reductase ArsC SCOP domains CATH domains 1rxeA00 A:1-131 [code=3.40.50.270, no name defined] CATH domains Pfam domains -----LMWPc-1rxeA01 A:6-129 -- Pfam domains SAPs(SNPs) (1) -T-----------------------------------------------------G--------N---------------------V---S--T---------------P------------I---N--S- SAPs(SNPs) (1) SAPs(SNPs) (2) ------------------------------------------------------------------------------------------T-------------------------------V-------- SAPs(SNPs) (2) PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1rxe A 1 MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLSSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR 131 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (ARSC_STAAU | P0A006)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|