1LJL - JenaLib

Title :   WILD TYPE PI258 S. AUREUS ARSENATE REDUCTASE

Authors :   J. Messens, J. C. Martins, K. Van Belle, E. Brosens, A. Desmyter, M. De Gieter, J. M. Wieruszeski, R. Willem, L. Wyns, I. Zegers

Date :   21 Apr 02 (Deposition) - 07 Aug 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.01

Chains :   Asym./Biol. Unit : A

Keywords :   P-Loop, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Messens, J. C. Martins, K. Van Belle, E. Brosens, A. Desmyter, M. De Gieter, J. M. Wieruszeski, R. Willem, L. Wyns, I. Zegers
All Intermediates Of The Arsenate Reductase Mechanism, Including An Intramolecular Dynamic Disulfide Cascade.
Proc. Natl. Acad. Sci. Usa V. 99 8506 2002
PubMed-ID: 12072565 | Reference-DOI: 10.1073/PNAS.132142799
(for further references see the PDB file header)

Compounds

Molecule 1 - ARSENATE REDUCTASE
	Chains	:	A
	EC Number	:	1.97.1.5
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PTRC99
	Expression System Strain	:	JM109
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	ARSC
	Organism Scientific	:	STAPHYLOCOCCUS AUREUS
	Organism Taxid	:	1280
	Other Details	:	REDUCED
	Synonym	:	ARSENICAL PUMP MODIFIER

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (12, 12)

Asymmetric/Biological Unit (12, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_ARSC_STAAU_001 *	D	2	T	ARSC_STAAU	---	---	A	D	2	T
02	UniProt	VAR_ARSC_STAAU_002 *	D	56	G	ARSC_STAAU	---	---	A	D	56	G
03	UniProt	VAR_ARSC_STAAU_003 *	D	65	N	ARSC_STAAU	---	---	A	D	65	N
04	UniProt	VAR_ARSC_STAAU_004 *	N	87	V	ARSC_STAAU	---	---	A	N	87	V
05	UniProt	VAR_ARSC_STAAU_005 *	I	91	S	ARSC_STAAU	---	---	A	I	91	S
06	UniProt	VAR_ARSC_STAAU_006 *	I	91	T	ARSC_STAAU	---	---	A	I	91	T
07	UniProt	VAR_ARSC_STAAU_007 *	P	94	T	ARSC_STAAU	---	---	A	P	94	T
08	UniProt	VAR_ARSC_STAAU_008 *	E	110	P	ARSC_STAAU	---	---	A	E	110	P
09	UniProt	VAR_ARSC_STAAU_009 *	L	123	I	ARSC_STAAU	---	---	A	L	123	I
10	UniProt	VAR_ARSC_STAAU_010 *	L	123	V	ARSC_STAAU	---	---	A	L	123	V
11	UniProt	VAR_ARSC_STAAU_011 *	K	127	N	ARSC_STAAU	---	---	A	K	127	N
12	UniProt	VAR_ARSC_STAAU_012 *	L	130	S	ARSC_STAAU	---	---	A	L	130	S
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:130
 aligned with ARSC_STAAU | P0A006 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:130
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
           ARSC_STAAU     2 DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR 131
               SCOP domains d1ljla_ A: Arsenate reductase ArsC                                                                                                 SCOP domains
               CATH domains 1ljlA00 A:2-131  [code=3.40.50.270, no name defined]                                                                               CATH domains
               Pfam domains ----LMWPc-1ljlA01 A:6-129                                                                                                       -- Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhh.............hhhhhhhh.eeee.hhhhhhh........eeee.........hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) T-----------------------------------------------------G--------N---------------------V---S--T---------------P------------I---N--S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------T-------------------------------V-------- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ljl A   2 DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR 131
                                    11        21        31        41        51        61        71        81        91       101       111       121       131

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ARSC_STAAU | P0A006)

molecular function
	GO:0030612	arsenate reductase (thioredoxin) activity	Catalysis of the reaction: arsenate + thioredoxin = arsenite + thioredoxin disulfide. Thioredoxin disulfide is also known as oxidized thioredoxin.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0046685	response to arsenic-containing substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an arsenic stimulus from compounds containing arsenic, including arsenates, arsenites, and arsenides.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ljl)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ljl
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARSC_STAAU \| P0A006
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.97.1.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARSC_STAAU \| P0A006
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description