Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  SPINACH RUBISCO IN COMPLEX WITH THE INHIBITOR 2-CARBOXYARABINITOL-1,5-DIPHOSPHATE
 
Authors :  T. C. Taylor, I. Andersson
Date :  31 Oct 96  (Deposition) - 12 Mar 97  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  B,C,E,F,H,I,L,S
Biol. Unit 1:  B,C,E,F,H,I,L,S  (2x)
Keywords :  Lyase, Carbon-Carbon (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. C. Taylor, M. D. Fothergill, I. Andersson
A Common Structural Basis For The Inhibition Of Ribulose 1, 5-Bisphosphate Carboxylase By 4-Carboxyarabinitol 1, 5-Bisphosphate And Xylulose 1, 5-Bisphosphate.
J. Biol. Chem. V. 271 32894 1996
PubMed-ID: 8955130  |  Reference-DOI: 10.1074/JBC.271.51.32894
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE
    Chains: L, B, E, H
    EC Number: 4.1.1.39
    Organ: LEAF
    Organism Common: SPINACH
    Organism Scientific: SPINACIA OLERACEA
    Organism Taxid: 3562
    Synonym: RUBISCO
 
Molecule 2 - RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE
    Chains: S, C, F, I
    EC Number: 4.1.1.39
    Organ: LEAF
    Organism Common: SPINACH
    Organism Scientific: SPINACIA OLERACEA
    Organism Taxid: 3562
    Synonym: RUBISCO

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : BCEFHILS
Biological Unit 1 (2x): BCEFHILS

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1CAP4Ligand/Ion2-CARBOXYARABINITOL-1,5-DIPHOSPHATE
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1CAP8Ligand/Ion2-CARBOXYARABINITOL-1,5-DIPHOSPHATE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU E:60 , THR E:65 , TRP E:66 , ASN E:123 , THR L:173 , LYS L:175 , LYS L:177 , ASP L:203 , GLU L:204 , ARG L:295 , HIS L:327 , LYS L:334 , LEU L:335 , SER L:379 , GLY L:380 , GLY L:381 , GLY L:403 , GLY L:404 , HOH L:498 , HOH L:501 , HOH L:549 , HOH L:561 , HOH L:584 , HOH L:626 , HOH L:633 , HOH L:651BINDING SITE FOR RESIDUE CAP L 476
2AC2SOFTWAREGLU B:60 , THR B:65 , TRP B:66 , ASN B:123 , THR B:173 , LYS B:175 , LYS B:177 , ASP B:203 , GLU B:204 , ARG B:295 , HIS B:327 , LYS B:334 , LEU B:335 , SER B:379 , GLY B:380 , GLY B:381 , GLY B:403 , GLY B:404 , HOH B:501 , HOH B:504 , HOH B:552 , HOH B:564 , HOH B:586 , HOH B:628 , HOH B:635 , HOH B:653BINDING SITE FOR RESIDUE CAP B 476
3AC3SOFTWARETHR E:173 , LYS E:175 , LYS E:177 , ASP E:203 , GLU E:204 , ARG E:295 , HIS E:327 , LYS E:334 , LEU E:335 , SER E:379 , GLY E:380 , GLY E:381 , GLY E:403 , GLY E:404 , HOH E:501 , HOH E:504 , HOH E:552 , HOH E:564 , HOH E:587 , HOH E:629 , HOH E:636 , HOH E:654 , GLU L:60 , THR L:65 , TRP L:66 , ASN L:123BINDING SITE FOR RESIDUE CAP E 476
4AC4SOFTWAREGLU H:60 , THR H:65 , TRP H:66 , ASN H:123 , THR H:173 , LYS H:175 , LYS H:177 , ASP H:203 , GLU H:204 , ARG H:295 , HIS H:327 , LYS H:334 , LEU H:335 , SER H:379 , GLY H:380 , GLY H:381 , GLY H:403 , GLY H:404 , HOH H:502 , HOH H:505 , HOH H:553 , HOH H:565 , HOH H:587 , HOH H:629 , HOH H:636 , HOH H:654BINDING SITE FOR RESIDUE CAP H 476
5ACBUNKNOWNLYS B:201 , ASP B:203 , GLU B:204ACTIVE SITE
6ACEUNKNOWNLYS E:201 , ASP E:203 , GLU E:204ACTIVE SITE
7ACHUNKNOWNLYS H:201 , ASP H:203 , GLU H:204ACTIVE SITE
8ACLUNKNOWNLYS L:201 , ASP L:203 , GLU L:204ACTIVE SITE

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1B:247 -B:247
2E:247 -E:247
3H:247 -H:247
4L:247 -E:247

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Lys L:175 -Pro L:176
2Lys B:175 -Pro B:176
3Lys E:175 -Pro E:176
4Lys H:175 -Pro H:176

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 4)

Asymmetric Unit (1, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RBS1_SPIOL_001 *P94YRBS1_SPIOL  ---  ---C/F/I/SY94Y
   * ID not provided by source
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_RBS1_SPIOL_001 *P94YRBS1_SPIOL  ---  ---C/F/I/SY94Y
   * ID not provided by source
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RUBISCO_LARGEPS00157 Ribulose bisphosphate carboxylase large chain active site.RBL_SPIOL196-204
 
 
 		  4B:196-204
E:196-204
H:196-204
L:196-204
Biological Unit 1 (1, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RUBISCO_LARGEPS00157 Ribulose bisphosphate carboxylase large chain active site.RBL_SPIOL196-204
 
 
 		  8B:196-204
E:196-204
H:196-204
L:196-204

(-) Exons   (0, 0)

(no "Exon" information available for 1RBO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain B from PDB  Type:PROTEIN  Length:467
 aligned with RBL_SPIOL | P00875 from UniProtKB/Swiss-Prot  Length:475

    Alignment length:467
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       
            RBL_SPIOL     9 ASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
               SCOP domains d1rbob2 B:9-147 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                            d1rbob1 B:148-475 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains -------------1rboB01 B:22-148  [code=3.30.70.150, no name defined]                                                                          1rboB02 B:149-462 Rubisco                                                                                                                                                                                                                                                                                                 ------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhh...........eeeeeeee......hhhhhhhhhhh.........hhhhh..hhhh..eeeeeee.......eeeeeee.hhh.....hhhhhhhhh..hhh.....eeeeeeee..hhhhhh.......hhhhhhhh......eee..........hhhhhhhhhhhhhh...eee............hhhhhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhhhh...eeeeehhhh.hhhhhhhhhhhhhh..eeeee...hhhhh........hhhhhhhhhhh...eee...........hhhhhhhhhhhh.......hhh..............eeeee....hhhhhhhhhhh...eeee..hhhh.....hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RUBISCO_L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo B   9 ASVGFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       


Chain C from PDB  Type:PROTEIN  Length:123
 aligned with RBS1_SPIOL | P00870 from UniProtKB/Swiss-Prot  Length:123

    Alignment length:123
                                    10        20        30        40        50        60        70        80        90       100       110       120   
           RBS1_SPIOL     1 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPPLEFEVKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAGY 123
               SCOP domains d1rboc_ C: Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                  SCOP domains
               CATH domains 1rboC00 C:1-123  [code=3.30.190.10, no name defined]                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................hhhhhhhhhhhhh...eeeeeee......................eee.........hhhhhhhhhhhhhh....eeeeeee........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------Y----------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo C   1 MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKPAGY 123
                                    10        20        30        40        50        60        70        80        90       100       110       120   


Chain E from PDB  Type:PROTEIN  Length:467
 aligned with RBL_SPIOL | P00875 from UniProtKB/Swiss-Prot  Length:475

    Alignment length:467
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       
            RBL_SPIOL     9 ASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
               SCOP domains d1rboe2 E:9-147 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                            d1rboe1 E:148-475 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains -------------1rboE01 E:22-148  [code=3.30.70.150, no name defined]                                                                          1rboE02 E:149-462 Rubisco                                                                                                                                                                                                                                                                                                 ------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhh...........eeeeeeee......hhhhhhhhhhh.........hhhhh..hhhh..eeeeeee.......eeeeeee.hhh.....hhhhhhhhh..hhh.....eeeeeeee..hhhhhh.......hhhhhhhh......eee..........hhhhhhhhhhhhhh...eee............hhhhhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhhhh...eeeeehhhh.hhhhhhhhhhhhhh..eeeee...hhhhh........hhhhhhhhhhh...eee...........hhhhhhhhhhhh.......hhh..............eeeee....hhhhhhhhhhh...eeee..hhhh.....hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RUBISCO_L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo E   9 ASVGFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       


Chain F from PDB  Type:PROTEIN  Length:123
 aligned with RBS1_SPIOL | P00870 from UniProtKB/Swiss-Prot  Length:123

    Alignment length:123
                                    10        20        30        40        50        60        70        80        90       100       110       120   
           RBS1_SPIOL     1 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPPLEFEVKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAGY 123
               SCOP domains d1rbof_ F: Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                  SCOP domains
               CATH domains 1rboF00 F:1-123  [code=3.30.190.10, no name defined]                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................hhhhhhhhhhhhh...eeeeeee......................eee.........hhhhhhhhhhhhhh....eeeeeee........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------Y----------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo F   1 MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKPAGY 123
                                    10        20        30        40        50        60        70        80        90       100       110       120   


Chain H from PDB  Type:PROTEIN  Length:467
 aligned with RBL_SPIOL | P00875 from UniProtKB/Swiss-Prot  Length:475

    Alignment length:467
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       
            RBL_SPIOL     9 ASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
               SCOP domains d1rboh2 H:9-147 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                            d1rboh1 H:148-475 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains -------------1rboH01 H:22-148  [code=3.30.70.150, no name defined]                                                                          1rboH02 H:149-462 Rubisco                                                                                                                                                                                                                                                                                                 ------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhh...........eeeeeeee......hhhhhhhhhhh.........hhhhh..hhhh..eeeeeee.......eeeeeee.hhh.....hhhhhhhhh..hhh.....eeeeeeee..hhhhhh.......hhhhhhhh......eee..........hhhhhhhhhhhhhh...eee............hhhhhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhhhh...eeeeehhhh.hhhhhhhhhhhhhh..eeeee...hhhhh........hhhhhhhhhhh...eee...........hhhhhhhhhhhh.......hhh..............eeeee....hhhhhhhhhhh...eeee..hhhh.....hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RUBISCO_L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo H   9 ASVGFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       


Chain I from PDB  Type:PROTEIN  Length:123
 aligned with RBS1_SPIOL | P00870 from UniProtKB/Swiss-Prot  Length:123

    Alignment length:123
                                    10        20        30        40        50        60        70        80        90       100       110       120   
           RBS1_SPIOL     1 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPPLEFEVKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAGY 123
               SCOP domains d1rboi_ I: Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                  SCOP domains
               CATH domains 1rboI00 I:1-123  [code=3.30.190.10, no name defined]                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................hhhhhhhhhhhhh...eeeeeee......................eee.........hhhhhhhhhhhhhh....eeeeeee........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------Y----------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo I   1 MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKPAGY 123
                                    10        20        30        40        50        60        70        80        90       100       110       120   


Chain L from PDB  Type:PROTEIN  Length:467
 aligned with RBL_SPIOL | P00875 from UniProtKB/Swiss-Prot  Length:475

    Alignment length:467
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       
            RBL_SPIOL     9 ASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
               SCOP domains d1rbol2 L:9-147 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                            d1rbol1 L:148-475 Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains -------------1rboL01 L:22-148  [code=3.30.70.150, no name defined]                                                                          1rboL02 L:149-462 Rubisco                                                                                                                                                                                                                                                                                                 ------------- CATH domains
           Pfam domains (1) ------------RuBisCO_large_N-1rboL05 L:21-146                                                                                              -------RuBisCO_large-1rboL01 L:154-462                                                                                                                                                                                                                                                                                      ------------- Pfam domains (1)
           Pfam domains (2) ------------RuBisCO_large_N-1rboL06 L:21-146                                                                                              -------RuBisCO_large-1rboL02 L:154-462                                                                                                                                                                                                                                                                                      ------------- Pfam domains (2)
           Pfam domains (3) ------------RuBisCO_large_N-1rboL07 L:21-146                                                                                              -------RuBisCO_large-1rboL03 L:154-462                                                                                                                                                                                                                                                                                      ------------- Pfam domains (3)
           Pfam domains (4) ------------RuBisCO_large_N-1rboL08 L:21-146                                                                                              -------RuBisCO_large-1rboL04 L:154-462                                                                                                                                                                                                                                                                                      ------------- Pfam domains (4)
         Sec.struct. author ...........hhhhh...........eeeeeeee......hhhhhhhhhhh.........hhhhh..hhhh..eeeeeee.......eeeeeee.hhh.....hhhhhhhhh..hhh.....eeeeeeee..hhhhhh.......hhhhhhhh......eee..........hhhhhhhhhhhhhh...eee............hhhhhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhhhh...eeeeehhhh.hhhhhhhhhhhhhh..eeeee...hhhhh........hhhhhhhhhhh...eee...........hhhhhhhhhhhh.......hhh..............eeeee....hhhhhhhhhhh...eeee..hhhh.....hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RUBISCO_L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo L   9 ASVGFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 475
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       


Chain S from PDB  Type:PROTEIN  Length:123
 aligned with RBS1_SPIOL | P00870 from UniProtKB/Swiss-Prot  Length:123

    Alignment length:123
                                    10        20        30        40        50        60        70        80        90       100       110       120   
           RBS1_SPIOL     1 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPPLEFEVKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAGY 123
               SCOP domains d1rbos_ S: Ribulose 1,5-bisphosphate carboxylase-oxygenase                                                                  SCOP domains
               CATH domains 1rboS00 S:1-123  [code=3.30.190.10, no name defined]                                                                        CATH domains
           Pfam domains (1) ----------RuBisCO_small-1rboS01 S:11-121                                                                                 -- Pfam domains (1)
           Pfam domains (2) ----------RuBisCO_small-1rboS02 S:11-121                                                                                 -- Pfam domains (2)
           Pfam domains (3) ----------RuBisCO_small-1rboS03 S:11-121                                                                                 -- Pfam domains (3)
           Pfam domains (4) ----------RuBisCO_small-1rboS04 S:11-121                                                                                 -- Pfam domains (4)
         Sec.struct. author ......................hhhhhhhhhhhhh...eeeeeee......................eee.........hhhhhhhhhhhhhh....eeeeeee........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------Y----------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rbo S   1 MQVWPILNLKKYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNREVQCISFIAYKPAGY 123
                                    10        20        30        40        50        60        70        80        90       100       110       120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 12)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (3, 12)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 12)

Asymmetric Unit
(-)
Clan: no clan defined [family: RuBisCO_large] (36)
(-)
Clan: no clan defined [family: RuBisCO_large_N] (27)
(-)
Clan: no clan defined [family: RuBisCO_small] (23)

(-) Gene Ontology  (13, 23)

Asymmetric Unit(hide GO term definitions)
Chain B,E,H,L   (RBL_SPIOL | P00875)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016984    ribulose-bisphosphate carboxylase activity    Catalysis of the reaction: D-ribulose 1,5-bisphosphate + CO2 + H2O = 2 3-phospho-D-glycerate.
biological process
    GO:0015977    carbon fixation    A metabolic process in which carbon (usually derived from carbon dioxide) is incorporated into organic compounds (usually carbohydrates).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0009853    photorespiration    A light-dependent catabolic process occurring concomitantly with photosynthesis in plants (especially C3 plants) whereby dioxygen (O2) is consumed and carbon dioxide (CO2) is evolved. The substrate is glycolate formed in large quantities in chloroplasts from 2-phosphoglycolate generated from ribulose 1,5-bisphosphate by the action of ribulose-bisphosphate carboxylase; the glycolate enters the peroxisomes where it is converted by glycolate oxidase to glyoxylate which undergoes transamination to glycine. This then passes into the mitochondria where it is decarboxylated forming one molecule of serine for every two molecules of glycine. This pathway also exists in photosynthetic bacteria.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019253    reductive pentose-phosphate cycle    The fixation of carbon dioxide (CO2) as glucose in the chloroplasts of C3 plants; uses ATP and NADPH formed in the light reactions of photosynthesis; carbon dioxide reacts with ribulose 1,5-bisphosphate (catalyzed by the function of ribulose-bisphosphate carboxylase) to yield two molecules of 3-phosphoglycerate; these are then phosphorylated by ATP to 1,3-bisphosphateglyceraldehyde which, in turn, is then reduced by NADPH to glyceraldehyde 3-phosphate. The glyceraldehyde 3-phosphate is converted to fructose 5-phosphate and ribulose 5-phosphate by aldolase and other enzymes; the ribulose 5-phosphate is phosphorylated by ATP to ribulose 1,5-bisphosphate.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.

Chain C,F,I,S   (RBS1_SPIOL | P00870)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016984    ribulose-bisphosphate carboxylase activity    Catalysis of the reaction: D-ribulose 1,5-bisphosphate + CO2 + H2O = 2 3-phospho-D-glycerate.
biological process
    GO:0015977    carbon fixation    A metabolic process in which carbon (usually derived from carbon dioxide) is incorporated into organic compounds (usually carbohydrates).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0009853    photorespiration    A light-dependent catabolic process occurring concomitantly with photosynthesis in plants (especially C3 plants) whereby dioxygen (O2) is consumed and carbon dioxide (CO2) is evolved. The substrate is glycolate formed in large quantities in chloroplasts from 2-phosphoglycolate generated from ribulose 1,5-bisphosphate by the action of ribulose-bisphosphate carboxylase; the glycolate enters the peroxisomes where it is converted by glycolate oxidase to glyoxylate which undergoes transamination to glycine. This then passes into the mitochondria where it is decarboxylated forming one molecule of serine for every two molecules of glycine. This pathway also exists in photosynthetic bacteria.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    ACB  [ RasMol ]  +environment [ RasMol ]
    ACE  [ RasMol ]  +environment [ RasMol ]
    ACH  [ RasMol ]  +environment [ RasMol ]
    ACL  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Lys B:175 - Pro B:176   [ RasMol ]  
    Lys E:175 - Pro E:176   [ RasMol ]  
    Lys H:175 - Pro H:176   [ RasMol ]  
    Lys L:175 - Pro L:176   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1rbo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RBL_SPIOL | P00875
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RBS1_SPIOL | P00870
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.1.1.39
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RBL_SPIOL | P00875
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RBS1_SPIOL | P00870
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RBL_SPIOL | P00875: 1aa1 1aus 1ir1 1rco 1rcx 1rxo 1upm 1upp 8ruc
        RBS1_SPIOL | P00870: 1rco 1rcx 1rxo 8ruc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1RBO)