Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRANSKETOLASE FROM LEISHMANIA MEXICANA
 
Authors :  N. J. Veitch, D. A. Mauger, J. J. Cazzulo, Y. Lindqvist, M. P. Barrett
Date :  30 Oct 03  (Deposition) - 09 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.22
Chains :  Asym./Biol. Unit :  A,B
Keywords :  3 Domains, Each Of The Alpha/Beta Type, Thiamine Diphosphate Binding Domain, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. J. Veitch, D. A. Maugeri, J. J. Cazzulo, Y. Lindqvist, M. P. Barrett
Transketolase From Leishmania Mexicana Has A Dual Subcellular Localization.
Biochem. J. V. 382 759 2004
PubMed-ID: 15149284  |  Reference-DOI: 10.1042/BJ20040459
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRANSKETOLASE
    Chains: A, B
    EC Number: 2.2.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: LEISHMANIA MEXICANA MEXICANA
    Organism Taxid: 44270
    Strain: MEXICANA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION
2TPP2Ligand/IonTHIAMINE DIPHOSPHATE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:155 , ASN A:185 , ILE A:187 , TPP A:1671 , HOH A:1793BINDING SITE FOR RESIDUE CA A 1670
2AC2SOFTWAREASP B:155 , ASN B:185 , ILE B:187 , TPP B:2671 , HOH B:2836BINDING SITE FOR RESIDUE CA B 2670
3AC3SOFTWARETHR A:29 , HIS A:66 , GLY A:114 , LEU A:116 , ASP A:155 , GLY A:156 , GLU A:160 , ASN A:185 , ILE A:187 , SER A:188 , ILE A:189 , ILE A:248 , HIS A:261 , CA A:1670 , HOH A:1743 , HOH A:1898 , ASP B:376 , GLU B:409 , PHE B:435 , TYR B:438 , HIS B:471BINDING SITE FOR RESIDUE TPP A 1671
4AC4SOFTWAREASP A:376 , GLU A:409 , PHE A:435 , TYR A:438 , HIS A:471 , THR B:29 , HIS B:66 , GLY B:114 , LEU B:116 , ASP B:155 , GLY B:156 , GLU B:160 , ASN B:185 , ILE B:187 , ILE B:189 , ILE B:248 , HIS B:261 , CA B:2670 , HOH B:2695 , HOH B:2788BINDING SITE FOR RESIDUE TPP B 2671

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1R9J)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1R9J)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1R9J)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1R9J)

(-) Exons   (0, 0)

(no "Exon" information available for 1R9J)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:670
 aligned with Q8MPM3_LEIME | Q8MPM3 from UniProtKB/TrEMBL  Length:671

    Alignment length:670
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669
         Q8MPM3_LEIME     - -MASIEKVANCIRCLAADIVQGGKSGHPGTPMGMAPMSAVLWTEVMKYNSQDPDWVDRDRFVMSNGHGCALQYALLHMAGYNLTMDDLKGFRQDGSRTPGHPERFVTPGVEVTTGPLGQGIANAVGLAIAEAHLAATFNRPGYNIVDHYTYVYCGDGCLMEGVCQEALSLAGHLALEKLIVIYDSNYISIDGSTSLSFTEQCHQKYVAMGFHVIEVKNGDTDYEGLRKALAEAKATKGKPKMIVQTTTIGFGSSKQGTEKVHGAPLGEEDIANIKAKFGRDPQKKYDVDDDVRAVFRMHIDKCSAEQKAWEELLAKYTAAFPAEGAAFVAQMRGELPSGWEAKLPTNSSAIATRKASENCLAVLFPAIPALMGGSADLTPSNLTRPASANLVDFSSSSKEGRYIRFGVREHAMCAILNGLDAHDGIIPFGGTFLNFIGYALGAVRLAAISHHRVIYVATHDSIGVGEDGPTHQPVELVAALRAMPNLQVIRPSDQTETSGAWAVALSSIHTPTVLCLSRQNTEPQSGSSIEGVRHGAYSVVDVPDLQLVIVASGSEVSLAVDAAKALSGELRVRVVSMPCQELFDAQPDTYRQAVLPAGVPVVSVEAYVSFGWEKYSHAHVGMSGFGASAPAGVLYKKFGITVEEVVRTGRELAKRFPDGTAPLKNSSFS 669
               SCOP domains -d1r9ja2 A:1-336 Transketolase (TK), PP module                                                                                                                                                                                                                                                                                                   d1r9ja1 A:337-526 Transketolase (TK), Pyr module                                                                                                                                              d1r9ja3 A:527-669 Transketolase (TK), C-domain                                                                                                  SCOP domains
               CATH domains 1r9jA01 A:0-333  [code=3.40.50.970, no name defined]                                                                                                                                                                                                                                                                                          1r9jA02 A:334-534  [code=3.40.50.970, no name defined]                                                                                                                                                   1r9jA03 A:535-669  [code=3.40.50.920, no name defined]                                                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...............eeee.hhhhhhhhhhhhhhhh...hhhhhhh...........................hhhhhhhhhhhhhhhhhhhhhh..........eeeeeehhhhhhhhhhhhhhhhhhhh...eeeeeee.......hhhhh...hhhhhhhhh..eeeee.....hhhhhhhhhhhhhhh....eeeeee...........hhhhh....hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh......eehhhhhhhhhhhhhhhh..eeeee..hhhhhh..hhhhh............eee...hhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhhhhhhhh...eeeee..hhhhh.........hhhhhhhhh...eee...hhhhhhhhhhhhhhh....eeee....ee......hhhhhhh..eeee......eeeee...hhhhhhhhhhhhh....eeeee..hhhhhhh.hhhhhhhhh.....eeee......hhhhh..eee.........hhhhhhhhh..hhhhhhhhhhhhhhhh.......hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1r9j A   0 HMASIEKVANCIRCLAADIVQGGKSGHPGTPMGMAPMSAVLWTEVMKYNSQDPDWVDRDRFVMSNGHGCALQYALLHMAGYNLTMDDLKGFRQDGSRTPGHPERFVTPGVEVTTGPLGQGIANAVGLAIAEAHLAATFNRPGYNIVDHYTYVYCGDGCLMEGVCQEALSLAGHLALEKLIVIYDSNYISIDGSTSLSFTEQCHQKYVAMGFHVIEVKNGDTDYEGLRKALAEAKATKGKPKMIVQTTTIGFGSSKQGTEKVHGAPLGEEDIANIKAKFGRDPQKKYDVDDDVRAVFRMHIDKCSAEQKAWEELLAKYTAAFPAEGAAFVAQMRGELPSGWEAKLPTNSSAIATRKASENCLAVLFPAIPALMGGSADLTPSNLTRPASANLVDFSSSSKEGRYIRFGVREHAMCAILNGLDAHDGIIPFGGTFLNFIGYALGAVRLAAISHHRVIYVATHDSIGVGEDGPTHQPVELVAALRAMPNLQVIRPSDQTETSGAWAVALSSIHTPTVLCLSRQNTEPQSGSSIEGVRHGAYSVVDVPDLQLVIVASGSEVSLAVDAAKALSGELRVRVVSMPCQELFDAQPDTYRQAVLPAGVPVVSVEAYVSFGWEKYSHAHVGMSGFGASAPAGVLYKKFGITVEEVVRTGRELAKRFPDGTAPLKNSSFS 669
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669


Chain B from PDB  Type:PROTEIN  Length:671
 aligned with Q8MPM3_LEIME | Q8MPM3 from UniProtKB/TrEMBL  Length:671

    Alignment length:671
                              1                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668 
         Q8MPM3_LEIME     - --MASIEKVANCIRCLAADIVQGGKSGHPGTPMGMAPMSAVLWTEVMKYNSQDPDWVDRDRFVMSNGHGCALQYALLHMAGYNLTMDDLKGFRQDGSRTPGHPERFVTPGVEVTTGPLGQGIANAVGLAIAEAHLAATFNRPGYNIVDHYTYVYCGDGCLMEGVCQEALSLAGHLALEKLIVIYDSNYISIDGSTSLSFTEQCHQKYVAMGFHVIEVKNGDTDYEGLRKALAEAKATKGKPKMIVQTTTIGFGSSKQGTEKVHGAPLGEEDIANIKAKFGRDPQKKYDVDDDVRAVFRMHIDKCSAEQKAWEELLAKYTAAFPAEGAAFVAQMRGELPSGWEAKLPTNSSAIATRKASENCLAVLFPAIPALMGGSADLTPSNLTRPASANLVDFSSSSKEGRYIRFGVREHAMCAILNGLDAHDGIIPFGGTFLNFIGYALGAVRLAAISHHRVIYVATHDSIGVGEDGPTHQPVELVAALRAMPNLQVIRPSDQTETSGAWAVALSSIHTPTVLCLSRQNTEPQSGSSIEGVRHGAYSVVDVPDLQLVIVASGSEVSLAVDAAKALSGELRVRVVSMPCQELFDAQPDTYRQAVLPAGVPVVSVEAYVSFGWEKYSHAHVGMSGFGASAPAGVLYKKFGITVEEVVRTGRELAKRFPDGTAPLKNSSFS 669
               SCOP domains --d1r9jb2 B:1-336 Transketolase (TK), PP module                                                                                                                                                                                                                                                                                                   d1r9jb1 B:337-526 Transketolase (TK), Pyr module                                                                                                                                              d1r9jb3 B:527-669 Transketolase (TK), C-domain                                                                                                  SCOP domains
               CATH domains 1r9jB01 B:-1-333  [code=3.40.50.970, no name defined]                                                                                                                                                                                                                                                                                          1r9jB02 B:334-534  [code=3.40.50.970, no name defined]                                                                                                                                                   1r9jB03 B:535-669  [code=3.40.50.920, no name defined]                                                                                  CATH domains
           Pfam domains (1) ----Transketolase_N-1r9jB03 B:3-336                                                                                                                                                                                                                                                                                                               -----------Transket_pyr-1r9jB01 B:348-524                                                                                                                                                   -----------Transketolase_C-1r9jB05 B:536-645                                                                             ------------------------ Pfam domains (1)
           Pfam domains (2) ----Transketolase_N-1r9jB04 B:3-336                                                                                                                                                                                                                                                                                                               -----------Transket_pyr-1r9jB02 B:348-524                                                                                                                                                   -----------Transketolase_C-1r9jB06 B:536-645                                                                             ------------------------ Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..............eeee.hhhhhhhhhhhhhhh....hhhhhhh...........................hhhhhhhhhhhhhhhhhhhhhh..........eeeeehhhhhhhhhhhhhhhhhhhhh...eeeeeee..ee..ee.hhh...hhhhhhhhh..eeeee.....hhhhhhhhhhhhhhh....eeeeee...........hhhhh....hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh......eehhhhhhhhhhhhhhhh..eeeee..hhhhhh..hhhhh............eee...hhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhhhhhhhh...eeeee..hhhhh..hhhhh..hhhhhhhhh...eee...hhhhhhhhhhhhhhh....eeee....ee......hhhhhhh..eeee......eeeee...hhhhhhhhhhhh.....eeeee..hhhhhhh.hhhhhhhhh.....eeee......hhhhh..eee.........hhhhhhhhh..hhhhhhhhhhhhhhhh.......hhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1r9j B  -1 RHMASIEKVANCIRCLAADIVQGGKSGHPGTPMGMAPMSAVLWTEVMKYNSQDPDWVDRDRFVMSNGHGCALQYALLHMAGYNLTMDDLKGFRQDGSRTPGHPERFVTPGVEVTTGPLGQGIANAVGLAIAEAHLAATFNRPGYNIVDHYTYVYCGDGCLMEGVCQEALSLAGHLALEKLIVIYDSNYISIDGSTSLSFTEQCHQKYVAMGFHVIEVKNGDTDYEGLRKALAEAKATKGKPKMIVQTTTIGFGSSKQGTEKVHGAPLGEEDIANIKAKFGRDPQKKYDVDDDVRAVFRMHIDKCSAEQKAWEELLAKYTAAFPAEGAAFVAQMRGELPSGWEAKLPTNSSAIATRKASENCLAVLFPAIPALMGGSADLTPSNLTRPASANLVDFSSSSKEGRYIRFGVREHAMCAILNGLDAHDGIIPFGGTFLNFIGYALGAVRLAAISHHRVIYVATHDSIGVGEDGPTHQPVELVAALRAMPNLQVIRPSDQTETSGAWAVALSSIHTPTVLCLSRQNTEPQSGSSIEGVRHGAYSVVDVPDLQLVIVASGSEVSLAVDAAKALSGELRVRVVSMPCQELFDAQPDTYRQAVLPAGVPVVSVEAYVSFGWEKYSHAHVGMSGFGASAPAGVLYKKFGITVEEVVRTGRELAKRFPDGTAPLKNSSFS 669
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Clan: THDP-binding (106)
(-)
Clan: no clan defined [family: Transketolase_C] (40)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q8MPM3_LEIME | Q8MPM3)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004802    transketolase activity    Catalysis of the reversible transfer of a 2-carbon ketol group (CH2OH-CO-) from a ketose phosphate donor to an aldose phosphate acceptor.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TPP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1r9j)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r9j
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8MPM3_LEIME | Q8MPM3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.2.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8MPM3_LEIME | Q8MPM3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1R9J)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1R9J)