1QR0 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE 4'-PHOSPHOPANTETHEINYL TRANSFERASE SFP-COENZYME A COMPLEX

Authors :   K. Reuter, R. M. Mofid, A. M. Marahiel, R. Ficner

Date :   17 Jun 99 (Deposition) - 10 Dec 99 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)

Keywords :   Protein-Coenzyme A Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Reuter, M. R. Mofid, M. A. Marahiel, R. Ficner
Crystal Structure Of The Surfactin Synthetase-Activating Enzyme Sfp: A Prototype Of The 4'-Phosphopantetheinyl Transferase Superfamily.
Embo J. V. 18 6823 1999
PubMed-ID: 10581256 | Reference-DOI: 10.1093/EMBOJ/18.23.6823
(for further references see the PDB file header)

Molecule 1 - 4'-PHOSPHOPANTETHEINYL TRANSFERASE SFP
	Atcc	:	ATCC21332
	Chains	:	A
	Engineered	:	YES
	Expression System	:	BACILLUS SUBTILIS
	Expression System Gene	:	SFP
	Expression System Plasmid	:	PQE60
	Expression System Taxid	:	1423
	Expression System Vector Type	:	PLASMID
	Gene	:	SFP
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423

		1
Asymmetric Unit	:	A
Biological Unit 1 (1x)	:	A
Biological Unit 2 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 2)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A
2	MG	1	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	COA	2	Ligand/Ion	COENZYME A
2	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:107 , GLU A:109 , GLU A:151 , COA A:300 , HOH A:407	BINDING SITE FOR RESIDUE MG A 400
2	AC2	SOFTWARE	LYS A:31 , THR A:44 , TYR A:73 , GLY A:74 , LYS A:75 , PRO A:76 , ASN A:87 , ILE A:88 , SER A:89 , HIS A:90 , ASP A:107 , GLU A:151 , LYS A:155 , MG A:400 , HOH A:410 , HOH A:424 , HOH A:439 , HOH A:485 , HOH A:494 , HOH A:495 , HOH A:552 , HOH A:553 , HOH A:580	BINDING SITE FOR RESIDUE COA A 300

(no "SS Bond" information available for 1QR0)

Asymmetric Unit

No.	Residues
1	Leu A:182	-	Pro A:183

Asymmetric Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_SFP_BACSU_001 *	S	22	T	SFP_BACSU	---	---	A	T	22	T
2	UniProt	VAR_SFP_BACSU_002 *	C	97	G	SFP_BACSU	---	---	A	G	97	G
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_SFP_BACSU_001 *	S	22	T	SFP_BACSU	---	---	A	T	22	T
2	UniProt	VAR_SFP_BACSU_002 *	C	97	G	SFP_BACSU	---	---	A	G	97	G
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_SFP_BACSU_001 *	S	22	T	SFP_BACSU	---	---	A	T	22	T
2	UniProt	VAR_SFP_BACSU_002 *	C	97	G	SFP_BACSU	---	---	A	G	97	G
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1QR0)

(no "Exon" information available for 1QR0)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:228
 aligned with SFP_BACSU | P39135 from UniProtKB/Swiss-Prot  Length:224

    Alignment length:228
                                                                                                                                                                                                                                                         224    
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   |    
            SFP_BACSU     1 MKIYGIYMDRPLSQEENERFMSFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQLDKSDIRFSTQEYGKPCIPDLPDAHFNISHSGRWVICAFDSQPIGIDIEKTKPISLEIAKRFFSKTEYSDLLAKDKDEQTDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHQDGQVSIELPDSHSPCYIKTYEVDPGYKMAVCAAHPDFPEDITMVSYEELL----   -
               SCOP domains d1qr0a1 A:1-101 4'-Phosphopantetheinyl transferase SFP                                               d1qr0a2 A:102-228 4'-Phosphopantetheinyl transferase SFP                                                                        SCOP domains
               CATH domains 1qr0A01 A:1-103,A:207-228 4'-phosphopantetheinyl transferase                                           1qr0A02 A:104-206 4'-phosphopantetheinyl transferase                                                   1qr0A01                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ACPS-1qr0A01 A:103-206                                                                                  ---------------------- Pfam domains
         Sec.struct. author .eeeeee.....hhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh..hhhhh..ee.....ee.......eeeeeee..eeeeeee....eeeeee....hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeee.hhh.eeee........eeeee.....eeeeeee.........ee.hhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------T--------------------------------------------------------------------------G----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qr0 A   1 MKIYGIYMDRPLSQEENERFMTFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQLDKSDIRFSTQEYGKPCIPDLPDAHFNISHSGRWVIGAFDSQPIGIDIEKTKPISLEIAKRFFSKTEYSDLLAKDKDEQTDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHQDGQVSIELPDSHSPCYIKTYEVDPGYKMAVCAAHPDFPEDITMVSYEELLRAAA 228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: 4'-phosphopantetheinyl transferase (26)

Superfamily: 4'-phosphopantetheinyl transferase (26)

Family: 4'-Phosphopantetheinyl transferase SFP (1)

Protein domain: 4'-Phosphopantetheinyl transferase SFP (1)

Bacillus subtilis [TaxId: 1423] (1)

1a	d1qr0a1	A:1-101
1b	d1qr0a2	A:102-228

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Ribosomal Protein L22; Chain A (108)

Homologous Superfamily: 4'-phosphopantetheinyl transferase (15)

Bacillus subtilis. Organism_taxid: 1423. (1)

1a	1qr0A01	A:1-103,A:207-228
1b	1qr0A02	A:104-206

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: ACPS] (13)

Family: ACPS (13)

Bacillus subtilis (1)

ACPS-1qr0A01

A:103-206

Asymmetric Unit(hide GO term definitions)

Chain A (SFP_BACSU | P39135)

molecular function
	GO:0008897	holo-[acyl-carrier-protein] synthase activity	Catalysis of the reaction: CoA + substrate-serine = adenosine 3',5'-bisphosphate + substrate-serine-4'-phosphopantetheine. The transfer of the 4'-phosphopantetheine (Ppant) co-factor from coenzyme A to the hydroxyl side chain of the serine residue of acyl- or peptidyl-carrier protein (ACP or PCP) to convert them from the apo to the holo form.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0017000	antibiotic biosynthetic process	The chemical reactions and pathways resulting in the formation of an antibiotic, a substance produced by or derived from certain fungi, bacteria, and other organisms, that can destroy or inhibit the growth of other microorganisms.
	GO:0006633	fatty acid biosynthetic process	The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
	GO:0019878	lysine biosynthetic process via aminoadipic acid	The chemical reactions and pathways resulting in the formation of lysine by the aminoadipic pathway.
	GO:1900192	positive regulation of single-species biofilm formation	Any process that activates or increases the frequency, rate or extent of single-species biofilm formation.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:182 - Pro A:183	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qr0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SFP_BACSU \| P39135
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SFP_BACSU \| P39135
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SFP_BACSU \| P39135	:	2ge0 2ge1 4mrt

(no "Related Entries Specified in the PDB File" available for 1QR0)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 1)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File