|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (2, 3) Biological Unit 2 (2, 6) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (3, 3)
Asymmetric Unit
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1Q77) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Q77) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1Q77) |
Exons (0, 0)| (no "Exon" information available for 1Q77) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:138 aligned with Y178_AQUAE | O66565 from UniProtKB/Swiss-Prot Length:135 Alignment length:138 1 | 7 17 27 37 47 57 67 77 87 97 107 117 127 Y178_AQUAE - ---MKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK 135 SCOP domains d1q77a_ A: Hypothetical protein Aq_178 SCOP domains CATH domains 1q77A00 A:-2-135 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1q77 A -2 SNAmKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK 135 | 7 17 27 37 47 57 67 77 87 97 107 117 127 | 1-MSE Chain B from PDB Type:PROTEIN Length:138 aligned with Y178_AQUAE | O66565 from UniProtKB/Swiss-Prot Length:135 Alignment length:138 1 | 7 17 27 37 47 57 67 77 87 97 107 117 127 Y178_AQUAE - ---MKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK 135 SCOP domains d1q77b_ B: Hypothetical protein Aq_178 SCOP domains CATH domains 1q77B00 B:-2-135 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1 CATH domains Pfam domains (1) ---Usp-1q77B01 B:1-132 --- Pfam domains (1) Pfam domains (2) ---Usp-1q77B02 B:1-132 --- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1q77 B -2 SNAmKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK 135 | 7 17 27 37 47 57 67 77 87 97 107 117 127 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)
Asymmetric Unit
|
Pfam Domains (1, 2)| Asymmetric Unit |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Y178_AQUAE | O66565)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|