1Q5H - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HUMAN DUTP PYROPHOSPHATASE COMPLEX WITH DUDP

Authors :   C. D. Mol, J. M. Harris, E. M. Mcintosh, J. A. Tainer

Date :   07 Aug 03 (Deposition) - 19 Aug 03 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Dna Repair, Enzyme-Dna Interactions, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. D. Mol, J. M. Harris, E. M. Mcintosh, J. A. Tainer
Human Dutp Pyrophosphatase: Uracil Recognition By A Beta Hairpin And Active Sites Formed By Three Separate Subunits
Structure V. 4 1077 1996
PubMed-ID: 8805593 | Reference-DOI: 10.1016/S0969-2126(96)00114-1

Molecule 1 - DUTP PYROPHOSPHATASE
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PEM409
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 4)

No.	Name	Count	Type	Full Name
1	DUD	3	Ligand/Ion	DEOXYURIDINE-5'-DIPHOSPHATE
2	MG	1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLU A:112 , HOH A:1012 , GLU B:112 , GLU C:112	BINDING SITE FOR RESIDUE MG A 999
2	AC2	SOFTWARE	ALA A:75 , GLY A:76 , VAL A:77 , ILE A:78 , ASP A:79 , TYR A:82 , GLY A:87 , HOH A:1008 , HOH A:1043 , HOH A:1046 , GLU B:129 , GLY B:134 , PHE B:135 , GLY B:136 , ARG C:62 , SER C:63 , GLY C:64	BINDING SITE FOR RESIDUE DUD A 779
3	AC3	SOFTWARE	ARG A:62 , SER A:63 , GLY A:64 , ALA B:75 , GLY B:76 , VAL B:77 , ILE B:78 , ASP B:79 , TYR B:82 , GLY B:87 , HOH B:801 , HOH B:846 , ARG C:130 , GLY C:134 , PHE C:135 , GLY C:136	BINDING SITE FOR RESIDUE DUD B 778
4	AC4	SOFTWARE	ARG B:62 , SER B:63 , GLY B:64 , ARG B:105 , ALA C:75 , GLY C:76 , VAL C:77 , ILE C:78 , ASP C:79 , TYR C:82 , GLY C:87 , HOH C:796 , HOH C:814 , HOH C:816 , HOH C:844	BINDING SITE FOR RESIDUE DUD C 777

(no "SS Bond" information available for 1Q5H)

(no "Cis Peptide Bond" information available for 1Q5H)

(no "SAP(SNP)/Variant" information available for 1Q5H)

(no "PROSITE Motif" information available for 1Q5H)

Asymmetric/Biological Unit (7, 19)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000331200	1b	ENSE00001487133	chr15:48623621-48623992	372	DUT_HUMAN	1-94	94	1	- - C:-5--1	- - 5
1.2b	ENST00000331200	2b	ENSE00001789447	chr15:48624465-48624603	139	DUT_HUMAN	94-140	47	3	A:1-29 B:1-29 C:0-29	29 29 30
1.3	ENST00000331200	3	ENSE00000686853	chr15:48626614-48626705	92	DUT_HUMAN	140-171	32	3	A:29-60 B:29-60 C:29-60	32 32 32
1.4	ENST00000331200	4	ENSE00000686856	chr15:48628243-48628287	45	DUT_HUMAN	171-186	16	3	A:60-75 B:60-75 C:60-75	16 16 16
1.5	ENST00000331200	5	ENSE00000686860	chr15:48633486-48633560	75	DUT_HUMAN	186-211	26	3	A:75-100 B:75-100 C:75-100	26 26 26
1.6	ENST00000331200	6	ENSE00000884477	chr15:48633712-48633782	71	DUT_HUMAN	211-234	24	3	A:100-123 B:100-123 C:100-123	24 24 24
1.7b	ENST00000331200	7b	ENSE00001030201	chr15:48634219-48635570	1352	DUT_HUMAN	235-252	18	3	A:124-127 B:124-136 C:124-136	4 13 13

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:127
 aligned with DUT_HUMAN | P33316 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:127
                                   121       131       141       151       161       171       181       191       201       211       221       231       
            DUT_HUMAN   112 MQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDD 238
               SCOP domains d1q5ha_ A: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)                                                           SCOP domains
               CATH domains 1q5hA00 A:1-127  [code=2.70.40.10, no name defined]                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.................eeee....eee...eeeeee..eeee....eeeeee.hhhhhhhhheeee..ee........eeeeee.....eee....eeeeeeeee....eeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.3  PDB: A:29-60          --------------Exon 1.5  PDB: A:75-100   -----------------------1.7b Transcript 1 (1)
           Transcript 1 (2) Exon 1.2b  PDB: A:1-29       ------------------------------Exon 1.4        ------------------------Exon 1.6  PDB: A:100-123---- Transcript 1 (2)
                 1q5h A   1 MQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDD 127
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain B from PDB  Type:PROTEIN  Length:136
 aligned with DUT_HUMAN | P33316 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:136
                                   121       131       141       151       161       171       181       191       201       211       221       231       241      
            DUT_HUMAN   112 MQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFG 247
               SCOP domains d1q5hb_ B: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)                                                                    SCOP domains
               CATH domains 1q5hB00 B:1-136  [code=2.70.40.10, no name defined]                                                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee................eeeee....eee...eeeeee..eeee....eeeeee.hhhhhhhhheeee..ee........eeeeee.....eee....eeeeeeeee....eeee............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.3  PDB: B:29-60          --------------Exon 1.5  PDB: B:75-100   -----------------------Exon 1.7b     Transcript 1 (1)
           Transcript 1 (2) Exon 1.2b  PDB: B:1-29       ------------------------------Exon 1.4        ------------------------Exon 1.6  PDB: B:100-123------------- Transcript 1 (2)
                 1q5h B   1 MQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFG 136
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain C from PDB  Type:PROTEIN  Length:142
 aligned with DUT_HUMAN | P33316 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:201
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246 
            DUT_HUMAN    47 RAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFG 247
               SCOP domains d1q5h                                                           c_ C: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)                                                                          SCOP domains
               CATH domains 1q5hC                                                           00 C:-5-136  [code=2.70.40.10, no name defined]                                                                                           CATH domains
           Pfam domains (1) --------------------------------------------------------------------------dUTPase-1q5hC01 C:10-136                                                                                                        Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------dUTPase-1q5hC02 C:10-136                                                                                                        Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------dUTPase-1q5hC03 C:10-136                                                                                                        Pfam domains (3)
         Sec.struct. author .....-----------------------------------------------------------..eeeeee.................eeee....eee...eeeeee..eeee....eeeeee.hhhhhhhhheeee..ee........eeeeee.....eee....eeeeeeeee.....eee............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1b  PDB: C:-5--1 UniProt: 1-94           ---------------------------------------------Exon 1.3  PDB: C:29-60          --------------Exon 1.5  PDB: C:75-100   -----------------------Exon 1.7b     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.2b  PDB: C:0-29 UniProt: 94-140         ------------------------------Exon 1.4        ------------------------Exon 1.6  PDB: C:100-123------------- Transcript 1 (2)
                 1q5h C  -5 HHHHH-----------------------------------------------------------HMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFG 136
                                |    -         -         -         -         -         -    |    5        15        25        35        45        55        65        75        85        95       105       115       125       135 
                               -1                                                           0

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: beta-clip (280)

Superfamily: dUTPase-like (122)

Family: dUTPase-like (71)

Protein domain: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (36)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1q5ha_	A:
1b	d1q5hb_	B:
1c	d1q5hc_	C:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Distorted Sandwich (506)

Topology: Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A (52)

Homologous Superfamily: [code=2.70.40.10, no name defined] (51)

Human (Homo sapiens) (4)

1a	1q5hC00	C:-5-136
1b	1q5hA00	A:1-127
1c	1q5hB00	B:1-136

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: dUTPase (38)

Family: dUTPase (38)

Homo sapiens (Human) (2)

1a	dUTPase-1q5hC01	C:10-136
1b	dUTPase-1q5hC02	C:10-136
1c	dUTPase-1q5hC03	C:10-136

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C (DUT_HUMAN | P33316)

molecular function
	GO:0004170	dUTP diphosphatase activity	Catalysis of the reaction: dUTP + H2O = dUMP + diphosphate.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006226	dUMP biosynthetic process	The chemical reactions and pathways resulting in the formation of dUMP, deoxyuridine monophosphate (2'-deoxyuridine 5'-phosphate).
	GO:0046081	dUTP catabolic process	The chemical reactions and pathways resulting in the breakdown of dUTP, deoxyuridine (5'-)triphosphate.
	GO:0046080	dUTP metabolic process	The chemical reactions and pathways involving dUTP, deoxyuridine (5'-)triphosphate.
	GO:0006139	nucleobase-containing compound metabolic process	Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
	GO:0009117	nucleotide metabolic process	The chemical reactions and pathways involving a nucleotide, a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the glycose moiety; may be mono-, di- or triphosphate; this definition includes cyclic nucleotides (nucleoside cyclic phosphates).
	GO:0046134	pyrimidine nucleoside biosynthetic process	The chemical reactions and pathways resulting in the formation of one of a family of organic molecules consisting of a pyrimidine base covalently bonded to a sugar ribose (a ribonucleoside) or deoxyribose (a deoxyribonucleoside).
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DUD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1q5h)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1q5h
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DUT_HUMAN \| P33316
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DUT_HUMAN \| P33316
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DUT_HUMAN \| P33316	:	1q5u 2hqu 3ara 3arn 3ehw 4mz5 4mz6

(no "Related Entries Specified in the PDB File" available for 1Q5H)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 19)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (1, 3)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File