1Q12 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE ATP-BOUND E. COLI MALK

Authors :   J. Chen, G. Lu, J. Lin, A. L. Davidson, F. A. Quiocho

Date :   18 Jul 03 (Deposition) - 30 Sep 03 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Atp-Binding Cassette, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Chen, G. Lu, J. Lin, A. L. Davidson, F. A. Quiocho
A Tweezers-Like Motion Of The Atp-Binding Cassette Dimer In An Abc Transport Cycle
Mol. Cell V. 12 651 2003
PubMed-ID: 14527411 | Reference-DOI: 10.1016/J.MOLCEL.2003.08.004

Molecule 1 - MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING PROTEIN MALK
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PKPS2E-86
	Expression System Strain	:	HN741
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	MALK OR B4035 OR Z5633 OR ECS5018
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	83333
	Strain	:	K12

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	ATP	4	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	ATP	2	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	ATP	2	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:129 , ALA A:133 , LEU A:134 , SER A:135 , GLY A:136 , GLY A:137 , GLN A:138 , ASN A:163 , TRP B:13 , VAL B:18 , SER B:38 , GLY B:39 , CYS B:40 , GLY B:41 , LYS B:42 , SER B:43 , THR B:44 , HIS B:192	BINDING SITE FOR RESIDUE ATP B 382
2	AC2	SOFTWARE	TRP A:13 , VAL A:18 , SER A:38 , GLY A:39 , CYS A:40 , GLY A:41 , LYS A:42 , SER A:43 , THR A:44 , HIS A:192 , ARG B:129 , LYS B:132 , ALA B:133 , SER B:135 , GLY B:136 , GLY B:137 , GLN B:138 , ASN B:163	BINDING SITE FOR RESIDUE ATP A 382
3	AC3	SOFTWARE	ARG C:129 , ALA C:133 , LEU C:134 , SER C:135 , GLY C:136 , GLY C:137 , GLN C:138 , ASN C:163 , TRP D:13 , VAL D:18 , SER D:38 , GLY D:39 , CYS D:40 , GLY D:41 , LYS D:42 , SER D:43 , THR D:44 , HIS D:192	BINDING SITE FOR RESIDUE ATP D 382
4	AC4	SOFTWARE	TRP C:13 , VAL C:18 , SER C:38 , GLY C:39 , CYS C:40 , GLY C:41 , LYS C:42 , SER C:43 , THR C:44 , HIS C:192 , ARG D:129 , LYS D:132 , ALA D:133 , SER D:135 , GLY D:136 , GLY D:137 , GLN D:138 , ASN D:163	BINDING SITE FOR RESIDUE ATP C 382

(no "SS Bond" information available for 1Q12)

(no "Cis Peptide Bond" information available for 1Q12)

(no "SAP(SNP)/Variant" information available for 1Q12)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ABC_TRANSPORTER_1	PS00211	ABC transporters family signature.	MALK_ECOLI	134-148	4	A:134-148 B:134-148 C:134-148 D:134-148

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ABC_TRANSPORTER_1	PS00211	ABC transporters family signature.	MALK_ECOLI	134-148	2	A:134-148 B:134-148 - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ABC_TRANSPORTER_1	PS00211	ABC transporters family signature.	MALK_ECOLI	134-148	2	- - C:134-148 D:134-148

(no "Exon" information available for 1Q12)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:367
 aligned with MALK_ECOLI | P68187 from UniProtKB/Swiss-Prot  Length:371

    Alignment length:367
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       
           MALK_ECOLI     4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
               SCOP domains d1q12a2 A:4-235 Maltose transport protein MalK, N-terminal domain                                                                                                                                                                       d1q12a1 A:236-370 Maltose transport protein MalK, C-terminal domain                                                                     SCOP domains
               CATH domains 1q12A01 A:4-238 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                       1q12A03 A:239-288,A:348-363                       -----------------------------------------------------------1q12A03         ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.ee..ee....eee......eeeee.....hhhhhhhhhhh.....eeee..........hhhhh.eeee................hhhhh..........hhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhhhh..eeeee..hhhhhhhhh.eeeeee..eeeeeehhhhhhhh..hhhhhhhh.....eeeeeeeee......eee.......eee............eeeeee.....ee......eeeeeeeeeee...eeeeeee.......eeeeee.........eeeee.hhhhheee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q12 A   4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363

Chain B from PDB  Type:PROTEIN  Length:367
 aligned with MALK_ECOLI | P68187 from UniProtKB/Swiss-Prot  Length:371

    Alignment length:367
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       
           MALK_ECOLI     4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
               SCOP domains d1q12b2 B:4-235 Maltose transport protein MalK, N-terminal domain                                                                                                                                                                       d1q12b1 B:236-370 Maltose transport protein MalK, C-terminal domain                                                                     SCOP domains
               CATH domains 1q12B01 B:4-238 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                       1q12B03 B:239-288,B:348-363                       -----------------------------------------------------------1q12B03         ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee..eeeeeee........eeeee.....hhhhhhhhh.......eeee................ee............hhhhhhh............hhhhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhhh..ee.........hhhhhhhhhhhhhhh......eeeee..hhhhhhhhh..eeeee..eeeeeehhhhhhhh..hhhhhhhh.....eeeeeeeee......eee.......eee............eeeeee.............eeeeeeeeeee...eeeeeee.......eeeeee.........eeeee.hhhhheee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q12 B   4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363

Chain C from PDB  Type:PROTEIN  Length:367
 aligned with MALK_ECOLI | P68187 from UniProtKB/Swiss-Prot  Length:371

    Alignment length:367
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       
           MALK_ECOLI     4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
               SCOP domains d1q12c2 C:4-235 Maltose transport protein MalK, N-terminal domain                                                                                                                                                                       d1q12c1 C:236-370 Maltose transport protein MalK, C-terminal domain                                                                     SCOP domains
               CATH domains 1q12C01 C:4-238 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                       1q12C03 C:239-288,C:348-363                       -----------------------------------------------------------1q12C03         ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.ee..ee....eee......eeeee.....hhhhhhhhhhh.....eeee..........hhhhh.eeee................hhhhh..........hhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhhhh..eeeee..hhhhhhhhh.eeeeee..eeeeeehhhhhhhh..hhhhhhhh.....eeeeeeeee......eee.......eee............eeeeee.....ee......eeeeeeeeeee...eeeeeee.......eeeeee.........eeeee.hhhhheee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q12 C   4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363

Chain D from PDB  Type:PROTEIN  Length:367
 aligned with MALK_ECOLI | P68187 from UniProtKB/Swiss-Prot  Length:371

    Alignment length:367
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       
           MALK_ECOLI     4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
               SCOP domains d1q12d2 D:4-235 Maltose transport protein MalK, N-terminal domain                                                                                                                                                                       d1q12d1 D:236-370 Maltose transport protein MalK, C-terminal domain                                                                     SCOP domains
               CATH domains 1q12D01 D:4-238 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                       1q12D03 D:239-288,D:348-363                       -----------------------------------------------------------1q12D03         ------- CATH domains
           Pfam domains (1) ---------------------------------------ABC_tran-1q12D05 D:43-162                                                                                               ------------------------------------------------------------------------------------------------------------------------TOBE_2-1q12D01 D:283-355                                                 --------------- Pfam domains (1)
           Pfam domains (2) ---------------------------------------ABC_tran-1q12D06 D:43-162                                                                                               ------------------------------------------------------------------------------------------------------------------------TOBE_2-1q12D02 D:283-355                                                 --------------- Pfam domains (2)
           Pfam domains (3) ---------------------------------------ABC_tran-1q12D07 D:43-162                                                                                               ------------------------------------------------------------------------------------------------------------------------TOBE_2-1q12D03 D:283-355                                                 --------------- Pfam domains (3)
           Pfam domains (4) ---------------------------------------ABC_tran-1q12D08 D:43-162                                                                                               ------------------------------------------------------------------------------------------------------------------------TOBE_2-1q12D04 D:283-355                                                 --------------- Pfam domains (4)
         Sec.struct. author ..eeeeeeee..eeeeeee........eeeee.....hhhhhhhhh.......eeee................ee............hhhhhhh............hhhhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhhh..ee.........hhhhhhhhhhhhhhh......eeeee..hhhhhhhhh..eeeee..eeeeeehhhhhhhh..hhhhhhhh.....eeeeeeeee......eee.......eee............eeeeee.............eeeeeeeeeee...eeeeeee.......eeeeee.........eeeee.hhhhheee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q12 D   4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG 370
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Escherichia coli k12. Organism_taxid: 83333. Strain: k12. (8)

1a	1q12A01	A:4-238
1b	1q12D01	D:4-238
1c	1q12B01	B:4-238
1d	1q12C01	C:4-238

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: OB fold (Dihydrolipoamide Acetyltransferase, E2P) (1040)

Homologous Superfamily: [code=2.40.50.100, no name defined] (113)

Escherichia coli k12. Organism_taxid: 83333. Strain: k12. (6)

2a	1q12A03	A:239-288,A:348-363
2b	1q12B03	B:239-288,B:348-363
2c	1q12C03	C:239-288,C:348-363
2d	1q12D03	D:239-288,D:348-363

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: OB (224)

Family: TOBE_2 (15)

Escherichia coli (strain K12) (7)

1a	TOBE_2-1q12D01	D:283-355
1b	TOBE_2-1q12D02	D:283-355
1c	TOBE_2-1q12D03	D:283-355
1d	TOBE_2-1q12D04	D:283-355

Clan: P-loop_NTPase (1112)

Family: ABC_tran (53)

Escherichia coli (strain K12) (10)

2a	ABC_tran-1q12D05	D:43-162
2b	ABC_tran-1q12D06	D:43-162
2c	ABC_tran-1q12D07	D:43-162
2d	ABC_tran-1q12D08	D:43-162

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (MALK_ECOLI | P68187)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0033613	activating transcription factor binding	Interacting selectively and non-covalently with an activating transcription factor, any protein whose activity is required to initiate or upregulate transcription.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016820	hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances	Catalysis of the hydrolysis of an acid anhydride to directly drive the transport of a substance across a membrane.
	GO:0015609	maltooligosaccharide-importing ATPase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + maltooligosaccharide(out) -> ADP + phosphate + maltooligosaccharide(in).
	GO:0015423	maltose-transporting ATPase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + maltose(out) = ADP + phosphate + maltose(in).
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0008643	carbohydrate transport	The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0042956	maltodextrin transport	The directed movement of maltodextrin, any polysaccharide of glucose residues in beta-(1,4) linkage, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015768	maltose transport	The directed movement of maltose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Maltose is the disaccharide 4-O-alpha-D-glucopyranosyl-D-glucopyranose, an intermediate in the catabolism of glycogen and starch.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0043190	ATP-binding cassette (ABC) transporter complex	A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
	GO:1990060	maltose transport complex	Protein complex facilitating ATP-dependent maltose transport through inner cell membrane (periplasm to cytoplasm) in Gram-negative bacteria. In E. coli the system is composed of a periplasmic maltose-binding protein (MBP), two integral membrane proteins, MalF and MalG, and two copies of the cytoplasmic ATP-binding cassette MalK.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ATP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1q12)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1q12
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MALK_ECOLI \| P68187
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MALK_ECOLI \| P68187
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (2, 8)

Gene Ontology (20, 20)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File