1PLS - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF A PLECKSTRIN HOMOLOGY DOMAIN

Authors :   H. S. Yoon, P. J. Hajduk, A. M. Petros, E. T. Olejniczak, R. P. Meadows, S. W. Fesik

Date :   03 May 94 (Deposition) - 03 Jun 95 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (25x)

Keywords :   Phosphorylation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. S. Yoon, P. J. Hajduk, A. M. Petros, E. T. Olejniczak, R. P. Meadows, S. W. Fesik
Solution Structure Of A Pleckstrin-Homology Domain.
Nature V. 369 672 1994
PubMed-ID: 8208296 | Reference-DOI: 10.1038/369672A0
(for further references see the PDB file header)

Molecule 1 - PLECKSTRIN HOMOLOGY DOMAIN
	Chains	:	A
	Engineered	:	YES
	Expression System Vector Type	:	PLASMID
	Gene	:	CDNA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606


NMR Structure (25x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1PLS)

(no "Site" information available for 1PLS)

(no "SS Bond" information available for 1PLS)

NMR Structure

No.	Model	Residues
1	1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25	Ser A:57	-	Pro A:58

NMR Structure (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_027797	R	5	W	PLEK_HUMAN	Polymorphism	17035364	A	R	5	W
2	UniProt	VAR_005524	W	92	R	PLEK_HUMAN	Polymorphism	---	A	W	92	R
3	UniProt	VAR_027798	K	97	N	PLEK_HUMAN	Polymorphism	3816281	A	N	97	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PH_DOMAIN	PS50003	PH domain profile.	PLEK_HUMAN	4-101 244-347	1	A:4-101 -
2	DEP	PS50186	DEP domain profile.	PLEK_HUMAN	136-221	1	A:106-113

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000234313	1a	ENSE00001911788	chr2:68592305-68592525	221	PLEK_HUMAN	1-14	14	1	A:1-14	14
1.2	ENST00000234313	2	ENSE00000963053	chr2:68607460-68607615	156	PLEK_HUMAN	15-66	52	1	A:15-66	52
1.3	ENST00000234313	3	ENSE00000758794	chr2:68607855-68608036	182	PLEK_HUMAN	67-127	61	1	A:67-105	39
1.4	ENST00000234313	4	ENSE00000758796	chr2:68609674-68609765	92	PLEK_HUMAN	127-158	32	1	A:106-113 (gaps)	10
1.5	ENST00000234313	5	ENSE00000758798	chr2:68613634-68613818	185	PLEK_HUMAN	158-219	62	0	-	-
1.6b	ENST00000234313	6b	ENSE00000758800	chr2:68615519-68615623	105	PLEK_HUMAN	220-254	35	0	-	-
1.7	ENST00000234313	7	ENSE00000758802	chr2:68620294-68620377	84	PLEK_HUMAN	255-282	28	0	-	-
1.8a	ENST00000234313	8a	ENSE00000758804	chr2:68621239-68621308	70	PLEK_HUMAN	283-306	24	0	-	-
1.9b	ENST00000234313	9b	ENSE00001163794	chr2:68622812-68624585	1774	PLEK_HUMAN	306-350	45	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with PLEK_HUMAN | P08567 from UniProtKB/Swiss-Prot  Length:350

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
           PLEK_HUMAN     1 MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNH 154
               SCOP domains d1plsa_ A: Pleckstrin                                                                                                                                      SCOP domains
               CATH domains 1plsA00 A:1-113 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)                                                                CATH domains
               Pfam domains ----PH-1plsA01 A:5-101                                                                               ----------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeee......eeeeeeeee..eeeee.........eee....eeeee.........eeeeeee...eeeeeee...hhhhhhhhhhhhhhhhh..---------------------------------------.....--... Sec.struct. author
                 SAPs(SNPs) ----W--------------------------------------------------------------------------------------R----N--------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---PH_DOMAIN  PDB: A:4-101 UniProt: 4-101                                                            ----------------------------------DEP  PDB: A:106-113 PROSITE
           Transcript 1 (1) Exon 1.1a     Exon 1.2  PDB: A:15-66 UniProt: 15-66               Exon 1.3  PDB: A:67-105 UniProt: 67-127 [INCOMPLETE]         --------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------Exon 1.4 UniProt: 127-158    Transcript 1 (2)
                 1pls A   1 MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEG---------------------------------------LEHHH--HHH 113
                                    10        20        30        40        50        60        70        80        90       100    |    -         -         -         -    |   |- |  
                                                                                                                                  105                                     106 110  |  
                                                                                                                                                                                 111

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: PH domain-like barrel (258)

Superfamily: PH domain-like (257)

Family: Pleckstrin-homology domain (PH domain) (102)

Protein domain: Pleckstrin (6)

Human (Homo sapiens) [TaxId: 9606] (6)

d1plsa_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: PH-domain like (150)

Homologous Superfamily: Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) (147)

Human (Homo sapiens) (85)

1plsA00

A:1-113

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PH (111)

Family: PH (71)

Homo sapiens (Human) (42)

PH-1plsA01

A:5-101

NMR Structure(hide GO term definitions)

Chain A (PLEK_HUMAN | P08567)

molecular function
	GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-3,4-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' and 4' positions.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0005080	protein kinase C binding	Interacting selectively and non-covalently with protein kinase C.
biological process
	GO:0031532	actin cytoskeleton reorganization	A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of constituent parts of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0030030	cell projection organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0030866	cortical actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of actin-based cytoskeletal structures in the cell cortex, i.e. just beneath the plasma membrane.
	GO:0002244	hematopoietic progenitor cell differentiation	The process in which precursor cell type acquires the specialized features of a hematopoietic progenitor cell, a class of cell types including myeloid progenitor cells and lymphoid progenitor cells.
	GO:0007229	integrin-mediated signaling pathway	A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0045744	negative regulation of G-protein coupled receptor protein signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
	GO:0050849	negative regulation of calcium-mediated signaling	Any process that stops, prevents, or reduces the frequency, rate or extent of calcium-mediated signaling.
	GO:0010920	negative regulation of inositol phosphate biosynthetic process	Any process that decreases the rate, frequency or extent of inositol phosphate biosynthesis. Inositol phosphate biosynthetic processes are the chemical reactions and pathways resulting in the formation of an inositol phosphate, 1,2,3,4,5,6-cyclohexanehexol, with one or more phosphate groups attached.
	GO:0046488	phosphatidylinositol metabolic process	The chemical reactions and pathways involving phosphatidylinositol, any glycophospholipid in which a sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0030845	phospholipase C-inhibiting G-protein coupled receptor signaling pathway	A G-protein coupled receptor signaling pathway which proceeds with inhibition of phospholipase C (PLC) activity and a subsequent decrease in the levels of cellular inositol trisphosphate (IP3) and diacylglycerol (DAG).
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0032233	positive regulation of actin filament bundle assembly	Any process that activates or increases the frequency, rate or extent of the assembly of actin filament bundles.
	GO:0030836	positive regulation of actin filament depolymerization	Any process that activates or increases the frequency, rate or extent of actin depolymerization.
	GO:0010925	positive regulation of inositol-polyphosphate 5-phosphatase activity	Any process that increases the rate or frequency of inositol-polyphosphate 5-phosphatase activity, the catalysis of the reactions: D-myo-inositol 1,4,5-trisphosphate + H2O = myo-inositol 1,4-bisphosphate + phosphate, and 1D-myo-inositol 1,3,4,5-tetrakisphosphate + H2O = 1D-myo-inositol 1,3,4-trisphosphate + phosphate.
	GO:0033625	positive regulation of integrin activation	Any process that activates or increases the frequency, rate, or extent of integrin activation.
	GO:0010572	positive regulation of platelet activation	Any process that increases the rate or frequency of platelet activation. Platelet activation is a series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue.
	GO:0070528	protein kinase C signaling	A series of reactions, mediated by the intracellular serine/threonine kinase protein kinase C, which occurs as a result of a single trigger reaction or compound.
	GO:0070560	protein secretion by platelet	The regulated release of proteins by a platelet or group of platelets.
	GO:0060305	regulation of cell diameter	Any process that modulates the diameter of a cell, the length of a line segment that crosses through the center of a circular section through a cell.
	GO:0031529	ruffle organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a ruffle, a projection at the leading edge of a crawling cell.
	GO:0070493	thrombin-activated receptor signaling pathway	The series of molecular signals generated as a consequence of a thrombin-activated receptor binding to one of its physiological ligands.
	GO:0006904	vesicle docking involved in exocytosis	The initial attachment of a vesicle membrane to a target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane, that contributes to exocytosis.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pls)

	Sites
(no "Sites" information available for 1pls)

	Cis Peptide Bonds
		Ser A:57 - Pro A:58	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1pls
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PLEK_HUMAN \| P08567
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PLEK_HUMAN \| P08567
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PLEK_HUMAN \| P08567	:	1w4m 1x05 1xx0 1zm0 2cso 2i5c 2i5f

(no "Related Entries Specified in the PDB File" available for 1PLS)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 25)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (2, 2)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (33, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File