|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1PC9) |
(no "Site" information available for 1PC9) |
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1PC9) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 4)
|
(no "Exon" information available for 1PC9) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:121 aligned with PA2H_BOTPA | Q9IAT9 from UniProtKB/Swiss-Prot Length:120 Alignment length:121 1 | 9 19 29 39 49 59 69 79 89 99 109 119 PA2H_BOTPA - -SFELGKMILQETGKNPAKSYGAYGCNCGVLGRGQPKDATDRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKKYRYHLKPFCKKADPC 120 SCOP domains d1pc9a_ A: Snake phospholipase A2 SCOP domains CATH domains 1pc9A00 A:1-133 Phospholipase A2 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------G-------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------PA2_HIS ----------------------------------PA2_ASP -------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1pc9 A 1 SLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGGPKDATDRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKKYRYHLKPFCKKADPC 133 10 || 21 31 41 51 || ||69 79 90 100 110 120 || ||132 13| 53| 61| 88| 123| || 15 57 67 90 125 || 127| 129 Chain B from PDB Type:PROTEIN Length:121 aligned with PA2H_BOTPA | Q9IAT9 from UniProtKB/Swiss-Prot Length:120 Alignment length:121 1 | 9 19 29 39 49 59 69 79 89 99 109 119 PA2H_BOTPA - -SFELGKMILQETGKNPAKSYGAYGCNCGVLGRGQPKDATDRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKKYRYHLKPFCKKADPC 120 SCOP domains d1pc9b_ B: Snake phospholipase A2 SCOP domains CATH domains 1pc9B00 B:1-133 Phospholipase A2 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------G-------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------PA2_HIS ----------------------------------PA2_ASP -------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1pc9 B 1 SLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGGPKDATDRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKKYRYHLKPFCKKADPC 133 10 || 21 31 41 51 || ||69 79 90 100 110 120 || ||132 13| 53| 61| 88| 123| || 15 57 67 90 125 || 127| 129
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1PC9) |
Asymmetric Unit(hide GO term definitions) Chain A,B (PA2H_BOTPA | Q9IAT9)
|
|
|
|
|
|
|