Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF ETD135, MUTANT OF THE ANTIFUNGAL DEFENSIN ARD1 FROM ARCHAEOPREPONA DEMOPHON
 
Authors :  C. Landon, M. Guenneugues, F. Barbault, M. Legrain, L. Menin, V. Schott, F. Vovelle, J. L. Dimarcq
Date :  10 Apr 03  (Deposition) - 09 Mar 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Alpha-Beta Protein, Csab Motif (Cysteine Stabilized Alpha- Helix Beta-Sheet Motif), Antifungal Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Landon, F. Barbault, M. Legrain, L. Menin, M. Guenneugues, V. Schott, F. Vovelle, J. L. Dimarcq
Lead Optimization Of Antifungal Peptides With 3D Nmr Structures Analysis.
Protein Sci. V. 13 703 2004
PubMed-ID: 14978308  |  Reference-DOI: 10.1110/PS.03404404
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DEFENSIN ARD1
    Chains: A
    Engineered: YES
    Expression System: SACCHAROMYCES CEREVISIAE
    Expression System Common: BAKER'S YEAST
    Expression System Plasmid: PEM35
    Expression System Taxid: 4932
    Expression System Vector Type: PLASMID
    Mutation: YES
    Organism Scientific: ARCHAEOPREPONA DEMOPHON
    Organism Taxid: 191427
    Other Details: ETD135 MUTANT

 Structural Features

(-) Chains, Units

  
NMR Structure (10x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1P0A)

(-) Sites  (0, 0)

(no "Site" information available for 1P0A)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:7 -A:32
2A:18 -A:40
3A:22 -A:42

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1P0A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1P0A)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INVERT_DEFENSINSPS51378 Invertebrate defensins family profile.DEFN_ARCDE4-44  1A:4-44

(-) Exons   (0, 0)

(no "Exon" information available for 1P0A)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:44
 aligned with DEFN_ARCDE | P84156 from UniProtKB/Swiss-Prot  Length:44

    Alignment length:44
                                    10        20        30        40    
            DEFN_ARCDE    1 DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET 44
               SCOP domains d1p0aa_ A: Defensin ARD1                     SCOP domains
               CATH domains 1p0aA00 A:1-44                               CATH domains
               Pfam domains ---Toxin_3-1p0aA01 A:4-44                    Pfam domains
         Sec.struct. author .eeeee..........hhhhhhhhhh..ee........eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------- SAPs(SNPs)
                    PROSITE ---INVERT_DEFENSINS  PDB: A:4-44             PROSITE
                 Transcript -------------------------------------------- Transcript
                  1p0a A  1 DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFLNVNCWCET 44
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Knottin_1 (78)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A   (DEFN_ARCDE | P84156)
biological process
    GO:0019732    antifungal humoral response    An immune response against a fungus mediated through a body fluid. An example of this process is the antifungal humoral response in Drosophila melanogaster.
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1p0a)
 
  Sites
(no "Sites" information available for 1p0a)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1p0a)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1p0a
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DEFN_ARCDE | P84156
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DEFN_ARCDE | P84156
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DEFN_ARCDE | P84156: 1ozz 1p00

(-) Related Entries Specified in the PDB File

1ozz STRUCTURE OF ARD1
1p00 STRUCTURE OF ETD151, MUTANT OF ARD1