|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1P00) |
Sites (0, 0)| (no "Site" information available for 1P00) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1P00) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1P00) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1P00) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:44 aligned with DEFN_ARCDE | P84156 from UniProtKB/Swiss-Prot Length:44 Alignment length:44 10 20 30 40 DEFN_ARCDE 1 DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET 44 SCOP domains d1p00a_ A: Defensin ARD1 SCOP domains CATH domains 1p00A00 A:1-44 CATH domains Pfam domains -------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------- SAPs(SNPs) PROSITE ---INVERT_DEFENSINS PDB: A:4-44 PROSITE Transcript -------------------------------------------- Transcript 1p00 A 1 DKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET 44 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1P00) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (DEFN_ARCDE | P84156)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|