1OU5 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN CCA-ADDING ENZYME

Authors :   M. A. Augustin, A. S. Reichert, H. Betat, R. Huber, M. Moerl, C. Steegborn

Date :   24 Mar 03 (Deposition) - 06 May 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.40

Chains :   Asym./Biol. Unit : A,B

Keywords :   Trna, Polymerase, Nucleotidyltransferase, Translation, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. A. Augustin, A. S. Reichert, H. Betat, R. Huber, M. Moerl, C. Steegborn
Crystal Structure Of The Human Cca-Adding Enzyme: Insights Into Template-Independent Polymerization
J. Mol. Biol. V. 328 985 2003
PubMed-ID: 12729736 | Reference-DOI: 10.1016/S0022-2836(03)00381-4
(for further references see the PDB file header)

Molecule 1 - TRNA CCA-ADDING ENZYME
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET30EK-LIC
	Expression System Strain	:	BL21(DE3)RP
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	HMTCCA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CCA-ADDING ENZYME; TRNA-NUCLEOTIDYLTRANSFERASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1OU5)

(no "Site" information available for 1OU5)

Asymmetric/Biological Unit

No.	Residues
1	A:344	-	B:344

(no "Cis Peptide Bond" information available for 1OU5)

Asymmetric/Biological Unit (6, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_072421	T	154	I	TRNT1_HUMAN	Disease (SIFD)	606231290	A/B	T	125	I
2	UniProt	VAR_072422	M	158	V	TRNT1_HUMAN	Disease (SIFD)	771781629	A/B	M	129	V
3	UniProt	VAR_072423	L	166	S	TRNT1_HUMAN	Disease (SIFD)	606231289	A/B	L	137	S
4	UniProt	VAR_072424	R	190	I	TRNT1_HUMAN	Disease (SIFD)	606231287	A/B	R	161	I
5	UniProt	VAR_072425	I	223	T	TRNT1_HUMAN	Disease (SIFD)	370011798	A/B	I	194	T
6	UniProt	VAR_072426	I	326	T	TRNT1_HUMAN	Disease (SIFD)	---	A/B	I	297	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1OU5)

Asymmetric/Biological Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000251607	1a	ENSE00001416815	chr3:3168600-3168674	75	TRNT1_HUMAN	-	0	0	-	-
1.2a	ENST00000251607	2a	ENSE00002201846	chr3:3170698-3170872	175	TRNT1_HUMAN	1-50	50	2	A:-1-21 B:-1-21	23 23
1.6c	ENST00000251607	6c	ENSE00000997141	chr3:3178944-3179137	194	TRNT1_HUMAN	50-114	65	2	A:21-85 B:21-85	65 65
1.7a	ENST00000251607	7a	ENSE00000997135	chr3:3182194-3182332	139	TRNT1_HUMAN	115-161	47	2	A:86-132 (gaps) B:86-132 (gaps)	47 47
1.8	ENST00000251607	8	ENSE00000997136	chr3:3186268-3186394	127	TRNT1_HUMAN	161-203	43	2	A:132-174 B:132-174	43 43
1.9b	ENST00000251607	9b	ENSE00001387479	chr3:3188114-3188307	194	TRNT1_HUMAN	203-268	66	2	A:174-239 B:174-239	66 66
1.10	ENST00000251607	10	ENSE00000851845	chr3:3189134-3189387	254	TRNT1_HUMAN	268-352	85	2	A:239-323 B:239-323	85 85
1.11b	ENST00000251607	11b	ENSE00001528667	chr3:3189590-3190707	1118	TRNT1_HUMAN	353-434	82	2	A:324-354 B:324-354	31 31

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:344
 aligned with TRNT1_HUMAN | Q96Q11 from UniProtKB/Swiss-Prot  Length:434

    Alignment length:356
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377      
          TRNT1_HUMAN    28 FTMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSI 383
               SCOP domains d1ou5a2 A:-1-150 tRNA CCA-adding enzyme, head domain                                                                                                    d1ou5a1 A:151-354 tRNA CCA-adding enzyme, C-terminal domains                                                                                                                                                 SCOP domains
               CATH domains 1ou5A01 A:-1-150 Beta Polymerase, domain 2                                                                                                              1ou5A02 A:151-354 cca-adding enzyme, domain 2                                                                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhh..hhhhhhhhhhhh...eeee...hhhhhhh......eeee..hhhhhhhhhh................eee......eeeee...------------.......hhhhh.hhhhh.ee.....ee...hhhhhh...................hhhhhhhhhhhhh.......hhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhhhhhhhh.hhhhhh......hhhhhhhhhhhh....hhhhhhhhhh.....hhhhhhhhh...hhhhhhhhhh...............hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------I---V-------S-----------------------I--------------------------------T------------------------------------------------------------------------------------------------------T--------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:-1-21----------------------------------------------------------------Exon 1.7a  PDB: A:86-132 (gaps)                ----------------------------------------------------------------------------------------------------------Exon 1.10  PDB: A:239-323 UniProt: 268-352                                           Exon 1.11b  PDB: A:324-354      Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.6c  PDB: A:21-85 UniProt: 50-114                          ----------------------------------------------Exon 1.8  PDB: A:132-174 UniProt: 161-203  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
           Transcript 1 (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: A:174-239 UniProt: 203-268                        ------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 1ou5 A  -1 DKMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRI------------FTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSI 354
                                     8        18        28        38        48        58        68        78        88        98         -  |    118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348      
                                                                                                                              98          111

Chain B from PDB  Type:PROTEIN  Length:344
 aligned with TRNT1_HUMAN | Q96Q11 from UniProtKB/Swiss-Prot  Length:434

    Alignment length:356
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377      
          TRNT1_HUMAN    28 FTMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSI 383
               SCOP domains d1ou5b2 B:-1-150 tRNA CCA-adding enzyme, head domain                                                                                                    d1ou5b1 B:151-354 tRNA CCA-adding enzyme, C-terminal domains                                                                                                                                                 SCOP domains
               CATH domains 1ou5B01 B:-1-150 Beta Polymerase, domain 2                                                                                                              1ou5B02 B:151-354 cca-adding enzyme, domain 2                                                                                                                                                                CATH domains
           Pfam domains (1) -------------------------------PolyA_pol-1ou5B01 B:30-153                                                                                                  --------------------------------PolyA_pol_RNAbd-1ou5B03 B:186-242                        ---------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------------------------PolyA_pol-1ou5B02 B:30-153                                                                                                  --------------------------------PolyA_pol_RNAbd-1ou5B04 B:186-242                        ---------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ......hhhhhhhh..hhhhhhhhhhhh...eeeehhhhhhhhhh......eeee..hhhhhhhhhh...............eeee......eeee....------------.............hhhhh.ee..........hhhhhh...................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh.....hhhhhhhhhh..hhhhhhhhhhhh.hhhhhh......hhhhhhhhhhhh....hhhhhhhhhh.....hhhhhhhhh...hhhhhhhhhh...............hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------I---V-------S-----------------------I--------------------------------T------------------------------------------------------------------------------------------------------T--------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:-1-21----------------------------------------------------------------Exon 1.7a  PDB: B:86-132 (gaps)                ----------------------------------------------------------------------------------------------------------Exon 1.10  PDB: B:239-323 UniProt: 268-352                                           Exon 1.11b  PDB: B:324-354      Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.6c  PDB: B:21-85 UniProt: 50-114                          ----------------------------------------------Exon 1.8  PDB: B:132-174 UniProt: 161-203  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
           Transcript 1 (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: B:174-239 UniProt: 203-268                        ------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 1ou5 B  -1 DKMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRI------------FTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSI 354
                                     8        18        28        38        48        58        68        78        88        98         -  |    118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348      
                                                                                                                              98          111

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Beta Polymerase; domain 2 (187)

Homologous Superfamily: Beta Polymerase, domain 2 (183)

Human (Homo sapiens) (22)

1a	1ou5A01	A:-1-150
1b	1ou5B01	B:-1-150

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: cca-adding enzyme, domain 2 (1)

Homologous Superfamily: cca-adding enzyme, domain 2 (1)

Human (Homo sapiens) (1)

2a	1ou5A02	A:151-354
2b	1ou5B02	B:151-354

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NTP_transf (45)

Family: PolyA_pol (4)

Homo sapiens (Human) (1)

1a	PolyA_pol-1ou5B01	B:30-153
1b	PolyA_pol-1ou5B02	B:30-153

Clan: no clan defined [family: PolyA_pol_RNAbd] (3)

Family: PolyA_pol_RNAbd (3)

Homo sapiens (Human) (1)

2a	PolyA_pol_RNAbd-1ou5B03	B:186-242
2b	PolyA_pol_RNAbd-1ou5B04	B:186-242

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (TRNT1_HUMAN | Q96Q11)

molecular function
	GO:0034062	5'-3' RNA polymerase activity	Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1); the synthesis of RNA from ribonucleotide triphosphates in the presence of a nucleic acid template, via extension of the 3'-end.
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0052929	ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity	Catalysis of the reaction: a tRNA with a 3' CC end + ATP = a tRNA with a 3' CCA end + diphosphate.
	GO:0052928	CTP:3'-cytidine-tRNA cytidylyltransferase activity	Catalysis of the reaction: a tRNA with a 3' cytidine + CTP = a tRNA with a 3' CC end + diphosphate.
	GO:0052927	CTP:tRNA cytidylyltransferase activity	Catalysis of the reaction: a tRNA precursor + CTP = a tRNA with a 3' cytidine end + diphosphate.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0004810	tRNA adenylyltransferase activity	Catalysis of the reaction: ATP + tRNA(n) = diphosphate + tRNA(n+1).
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006396	RNA processing	Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
	GO:1990180	mitochondrial tRNA 3'-end processing	The process in which the 3' end of a pre-tRNA molecule is converted to that of a mature tRNA in the mitochondrion.
	GO:0006626	protein targeting to mitochondrion	The process of directing proteins towards and into the mitochondrion, usually mediated by mitochondrial proteins that recognize signals contained within the imported protein.
	GO:0042780	tRNA 3'-end processing	The process in which the 3' end of a pre-tRNA molecule is converted to that of a mature tRNA.
	GO:0001680	tRNA 3'-terminal CCA addition	Post-transcriptional addition of the terminal 3' CCA sequence to a tRNA which does not encode this sequence within the primary transcript. CCA addition proceeds by the sequential addition of CTP, CTP, and then ATP to the 3' end of the tRNA, yielding a diphosphate with each nucleotide addition.
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ou5)

	Sites
(no "Sites" information available for 1ou5)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ou5)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ou5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TRNT1_HUMAN \| Q96Q11
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	616084
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TRNT1_HUMAN \| Q96Q11
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	TRNT1_HUMAN \| Q96Q11	:	4x4w

1miv	CRYSTAL STRUCTURE OF BACILLUS STEAROTHERMOPHILUS CCA-ADDING ENZYME
1miw	CRYSTAL STRUCTURE OF BACILLUS STEAROTHERMOPHILUS CCA-ADDING ENZYME
1miy	CRYSTAL STRUCTURE OF BACILLUS STEAROTHERMOPHILUS CCA-ADDING ENZYME

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 12)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File