1OLL - JenaLib

Title :   EXTRACELLULAR REGION OF THE HUMAN RECEPTOR NKP46

Authors :   M. Ponassi, C. Cantoni, R. Biassoni, R. Conte, A. Spallarossa, A. Pesce, A. Moretta, L. Moretta, M. Bolognesi, D. Bordo

Date :   07 Aug 03 (Deposition) - 04 Sep 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.93

Chains :   Asym./Biol. Unit : A

Keywords :   Immune System/Receptor, Nk Cell Triggering Receptor, Immune System, Ig Domain, Cytotoxicity, C2-Type Ig-Like Domains (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Ponassi, C. Cantoni, R. Biassoni, R. Conte, A. Spallarossa, A. Pesce, A. Moretta, L. Moretta, M. Bolognesi, D. Bordo
Structure Of The Human Nk Cell Triggering Receptor Nkp46 Ectodomain
Biochem. Biophys. Res. Commun. V. 309 317 2003
PubMed-ID: 12951052 | Reference-DOI: 10.1016/J.BBRC.2003.08.007

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (2, 2)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (0, 0)

Exons (3, 3)

Asymmetric/Biological Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000291890	1	ENSE00001380161	chr19:55417508-55417579	72	NCTR1_HUMAN	1-12	12	0	-	-
1.2	ENST00000291890	2	ENSE00001052311	chr19:55417657-55417692	36	NCTR1_HUMAN	12-24	13	0	-	-
1.3	ENST00000291890	3	ENSE00001052310	chr19:55417881-55418165	285	NCTR1_HUMAN	24-119	96	1	A:1-95	95
1.4	ENST00000291890	4	ENSE00001312058	chr19:55420604-55420882	279	NCTR1_HUMAN	119-212	94	1	A:95-188	94
1.5	ENST00000291890	5	ENSE00001052312	chr19:55421378-55421425	48	NCTR1_HUMAN	212-228	17	1	A:188-188	1
1.6a	ENST00000291890	6a	ENSE00001052306	chr19:55423536-55423586	51	NCTR1_HUMAN	228-245	18	0	-	-
1.7	ENST00000291890	7	ENSE00001308510	chr19:55424058-55424439	382	NCTR1_HUMAN	245-304	60	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:188
 aligned with NCTR1_HUMAN | O76036 from UniProtKB/Swiss-Prot  Length:304

    Alignment length:188
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204        
          NCTR1_HUMAN    25 TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTG 212
               SCOP domains d1olla1 A:1-95 Ligand binding domain of NK receptor NKp46                                      d1olla2 A:96-188 Ligand binding domain of NK receptor NKp46                                   SCOP domains
               CATH domains 1ollA01 A:1-95 Immunoglobulins                                                                 1ollA02 A:96-188 Immunoglobulins                                                              CATH domains
               Pfam domains ---Ig_2-1ollA01 A:4-93                                                                       -----Ig_3-1ollA02 A:99-171                                                    ----------------- Pfam domains
         Sec.struct. author .....eeeee...eee....eeeeee......eeeeee..eeeeee.........eeeeee...hhhhheeeeeeeee..ee......eeeeee......eeeee...eee...eeeeeee......eeeeeee....eeeeee...eeeeeeee.hhhhheeeeee.eee..ee......eeeeee. Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------------------------Q----Y----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------Y----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:1-95 UniProt: 24-119 [INCOMPLETE]                                             --------------------------------------------------------------------------------------------1 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------Exon 1.4  PDB: A:95-188 UniProt: 119-212                                                       Transcript 1 (2)
                 1oll A   1 TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTG 188
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (2, 2)

Gene Ontology (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (NCTR1_HUMAN | O76036)

molecular function
	GO:0005057	signal transducer activity, downstream of receptor	Conveys a signal from an upstream receptor or intracellular signal transducer, converting the signal into a form where it can ultimately trigger a change in the state or activity of a cell.
biological process
	GO:0006968	cellular defense response	A defense response that is mediated by cells.
	GO:0030101	natural killer cell activation	The change in morphology and behavior of a natural killer cell in response to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0042269	regulation of natural killer cell mediated cytotoxicity	Any process that modulates the frequency, rate, or extent of natural killer cell mediated cytotoxicity.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0016514	SWI/SNF complex	A SWI/SNF-type complex that contains nine or more proteins, including both conserved (core) and nonconserved components; the Swi2/Snf2 ATPase is one of the core components.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:10 - Pro A:11	[ RasMol ]
		His A:105 - Pro A:106	[ RasMol ]
		Lys A:49 - Pro A:50	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1oll
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NCTR1_HUMAN \| O76036
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description