|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (4, 6) Biological Unit 1 (2, 9) |
Asymmetric Unit (6, 6)
|
(no "SS Bond" information available for 1OHZ) |
(no "Cis Peptide Bond" information available for 1OHZ) |
(no "SAP(SNP)/Variant" information available for 1OHZ) |
Asymmetric Unit (2, 4)
|
(no "Exon" information available for 1OHZ) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:140 aligned with CIPA_CLOTH | Q06851 from UniProtKB/Swiss-Prot Length:1853 Alignment length:140 192 202 212 222 232 242 252 262 272 282 292 302 312 322 CIPA_CLOTH 183 GVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNVG 322 SCOP domains d1ohza_ A: Cohesin domain SCOP domains CATH domains 1ohzA00 A:5-144 [code=2.60.40.680, no name defined] CATH domains Pfam domains -Cohesin-1ohzA01 A:6-143 - Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ohz A 5 GVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNVG 144 14 24 34 44 54 64 74 84 94 104 114 124 134 144 Chain B from PDB Type:PROTEIN Length:56 aligned with XYNY_CLOTM | P51584 from UniProtKB/Swiss-Prot Length:1077 Alignment length:56 742 752 762 772 782 XYNY_CLOTM 733 GDVNGDGTINSTDLTMLKRSVLRAITLTDDAKARADVDKNGSINSTDVLLLSRYLL 788 SCOP domains d1ohzb_ B: Endo-1,4-beta-xylanase Y SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains (1) -----------------------------------Dockerin_1-1ohzB01 Pfam domains (1) Pfam domains (2) -----------------------------------Dockerin_1-1ohzB02 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (1) -CLOS_CELLULOSOME_RPT--------------CLOS_CELLULOSOME_RPT- PROSITE (1) PROSITE (2) -EF_HAND_1 ---------------------EF_HAND_1 -------- PROSITE (2) Transcript -------------------------------------------------------- Transcript 1ohz B 1 GDVNGDGTINSTDLTMLKRSVLRAITLTDDAKARADVDKNGSINSTDVLLLSRYLL 56 10 20 30 40 50
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit(hide GO term definitions) Chain A (CIPA_CLOTH | Q06851)
Chain B (XYNY_CLOTM | P51584)
|
|
|
|
|
|
|