1OHU - JenaLib

Asymmetric Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BH4_2	PS50063	Apoptosis regulator, Bcl-2 family BH4 motif profile.	CED9_CAEEL	80-99	2	A:80-99 B:80-99
2	BCL2_FAMILY	PS50062	BCL2-like apoptosis inhibitors family profile.	CED9_CAEEL	116-223	2	A:116-223 B:116-223
3	BH1	PS01080	Apoptosis regulator, Bcl-2 family BH1 motif signature.	CED9_CAEEL	160-179	2	A:165-179 B:160-179

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BH4_2	PS50063	Apoptosis regulator, Bcl-2 family BH4 motif profile.	CED9_CAEEL	80-99	1	A:80-99 -
2	BCL2_FAMILY	PS50062	BCL2-like apoptosis inhibitors family profile.	CED9_CAEEL	116-223	1	A:116-223 -
3	BH1	PS01080	Apoptosis regulator, Bcl-2 family BH1 motif signature.	CED9_CAEEL	160-179	1	A:165-179 -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BH4_2	PS50063	Apoptosis regulator, Bcl-2 family BH4 motif profile.	CED9_CAEEL	80-99	1	- B:80-99
2	BCL2_FAMILY	PS50062	BCL2-like apoptosis inhibitors family profile.	CED9_CAEEL	116-223	1	- B:116-223
3	BH1	PS01080	Apoptosis regulator, Bcl-2 family BH1 motif signature.	CED9_CAEEL	160-179	1	- B:160-179

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:166
 aligned with CED9_CAEEL | P41958 from UniProtKB/Swiss-Prot  Length:280

    Alignment length:172
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240  
           CED9_CAEEL    71 NDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEK 242
               SCOP domains d1ohua_ A: Apoptosis regulator ced-9                                                                                                                                         SCOP domains
               CATH domains 1ohuA00 A:71-242 Apoptosis Regulator Bcl-x                                                                                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh....------..hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------BH4_2  PDB: A:80-99 ----------------BCL2_FAMILY  PDB: A:116-223 UniProt: 116-223                                                                ------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------BH1  PDB: A:165-179 --------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ohu A  71 NDWEEPRLDIEGFVVDYFTHRIRQNGmEWFGAPGLPSGVQPEHEmmRVmGTIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVGN------PmSYGRLIGLISFGGFVAAKmmESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFmTLGKQmKEDYERAEAEK 242
                                    80        90      |100       110    || 120       130       140       150       | -    || 170       180    || 190       200       210       220    |  230|      240  
                                                     97-MSE           115-MSE                                    158    165|                185-MSE                                 225-MSE |           
                                                                       116-MSE                                           166-MSE             186-MSE                                      231-MSE       
                                                                          119-MSE

Chain B from PDB  Type:PROTEIN  Length:168
 aligned with CED9_CAEEL | P41958 from UniProtKB/Swiss-Prot  Length:280

    Alignment length:168
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234        
           CED9_CAEEL    75 EPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEK 242
               SCOP domains d1ohub_ B: Apoptosis regulator ced-9                                                                                                                                     SCOP domains
               CATH domains 1ohuB00 B:75-242 Apoptosis Regulator Bcl-x                                                                                                                               CATH domains
           Pfam domains (1) -BH4-1ohuB01 B:76-102       -------------Bcl-2-1ohuB03 B:116-221                                                                                   --------------------- Pfam domains (1)
           Pfam domains (2) -BH4-1ohuB02 B:76-102       -------------Bcl-2-1ohuB04 B:116-221                                                                                   --------------------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -----BH4_2  PDB: B:80-99 ----------------BCL2_FAMILY  PDB: B:116-223 UniProt: 116-223                                                                ------------------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------BH1  PDB: B:160-179 --------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1ohu B  75 EPRLDIEGFVVDYFTHRIRQNGmEWFGAPGLPSGVQPEHEmmRVmGTIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVGNAQTDQSPmSYGRLIGLISFGGFVAAKmmESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFmTLGKQmKEDYERAEAEK 242
                                    84        94  |    104       114||  |  124       134       144       154       164 |     174       184||     194       204       214       224|     |234        
                                                 97-MSE           115-MSE                                            166-MSE            185-MSE                                 225-MSE |           
                                                                   116-MSE                                                               186-MSE                                      231-MSE       
                                                                      119-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (2, 4)

Gene Ontology (22, 22)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CED9_CAEEL | P41958)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:1902742	apoptotic process involved in development	Any apoptotic process that is involved in anatomical structure development.
	GO:0000422	autophagy of mitochondrion	The autophagic process in which mitochondria are delivered to the vacuole and degraded in response to changing cellular conditions.
	GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
	GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of intrinsic apoptotic signaling pathway.
	GO:0043069	negative regulation of programmed cell death	Any process that stops, prevents, or reduces the frequency, rate or extent of programmed cell death, cell death resulting from activation of endogenous cellular processes.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0010636	positive regulation of mitochondrial fusion	Any process that increases the frequency, rate or extent of merging of two or more mitochondria within a cell to form a single compartment.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
cellular component
	GO:0012505	endomembrane system	A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031966	mitochondrial membrane	Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
	GO:0005741	mitochondrial outer membrane	The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0031090	organelle membrane	A membrane that is one of the two lipid bilayers of an organelle envelope or the outermost membrane of single membrane bound organelle.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ohu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CED9_CAEEL \| P41958
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 18)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 6)