Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SULA:FTSZ FROM PSEUDOMONAS AERUGINOSA
 
Authors :  S. C. Cordell, E. J. H. Robinson, J. Lowe
Date :  21 Apr 03  (Deposition) - 19 Jun 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B,X,Y
Keywords :  Bacterial Cell Division Inhibitor, Ftsz, Sula Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. C. Cordell, E. J. H. Robinson, J. Lowe
Crystal Structure Of The Sos Cell Division Inhibitor Sula And In Complex With Ftsz
Proc. Natl. Acad. Sci. Usa V. 100 7889 2003
PubMed-ID: 12808143  |  Reference-DOI: 10.1073/PNAS.1330742100

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PA3008
    Chains: X, Y
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PHIS17
    Expression System Taxid: 562
    Fragment: RESIDUES 43-161
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 287
    Other Details: FIRST 42 RESIDUES REMOVED FROM N-TERMINUS
    Synonym: SULA
 
Molecule 2 - CELL DIVISION PROTEIN FTSZ
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PHIS17
    Expression System Taxid: 562
    Fragment: RESIDUES 1-320
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 287
    Other Details: LAST 75 RESIDUES REMOVED FROM C-TERMINUS
    Synonym: FTSZ

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABXY

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1GDP2Ligand/IonGUANOSINE-5'-DIPHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:20 , GLY A:21 , GLY A:22 , ASN A:25 , GLY A:104 , GLY A:107 , GLY A:108 , THR A:109 , GLY A:110 , GLU A:139 , ARG A:143 , ASN A:166 , PHE A:183 , ALA A:186 , ASP A:187 , HOH A:2006 , HOH A:2080 , HOH A:2081 , HOH A:2082 , HOH A:2118 , HOH A:2178 , HOH A:2179 , HOH A:2180 , HOH A:2181 , HOH A:2182BINDING SITE FOR RESIDUE GDP A1318
2AC2SOFTWAREGLY B:20 , GLY B:21 , GLY B:22 , ASN B:25 , GLY B:104 , GLY B:107 , GLY B:108 , THR B:109 , GLY B:110 , PRO B:135 , GLU B:139 , ARG B:143 , ASN B:166 , PHE B:183 , ALA B:186 , ASP B:187 , LEU B:190 , HOH B:2050 , HOH B:2082 , HOH B:2150 , HOH B:2151 , HOH B:2152 , HOH B:2153 , HOH B:2154 , HOH B:2155 , HOH B:2156 , HOH B:2157 , HOH B:2158BINDING SITE FOR RESIDUE GDP B1318

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OFU)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Glu X:134 -Pro X:135
2Glu Y:134 -Pro Y:135

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OFU)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FTSZ_1PS01134 FtsZ protein signature 1.FTSZ_PSEAE44-78
 		  2A:44-78
B:44-78
2FTSZ_2PS01135 FtsZ protein signature 2.FTSZ_PSEAE97-118
 		  2A:97-118
B:97-118

(-) Exons   (0, 0)

(no "Exon" information available for 1OFU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:307
 aligned with FTSZ_PSEAE | P47204 from UniProtKB/Swiss-Prot  Length:394

    Alignment length:307
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       
           FTSZ_PSEAE    11 TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINVDFADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADMRDELHVTVVATGLG 317
               SCOP domains d1ofua1 A:11-208 Cell-division protein FtsZ                                                                                                                                                           d1ofua2 A:209-317 Cell-division protein FtsZ                                                                  SCOP domains
               CATH domains -1ofuA01 A:12-224  [code=3.40.50.1440, no name defined]                                                                                                                                                               1ofuA02 A:225-317  [code=3.30.1330.20, no name defined]                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeehhhhhhhhhhhhhh....eeeeeee..hhhhh.....eeee.hhhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhhh..eeeeeeee.hhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh..eeeeeeeeeee..hhhhhhhhhhhhhhhhh..hhhhh.eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee......eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------FTSZ_1  PDB: A:44-78 UniProt: 44-78------------------FTSZ_2  PDB: A:97-118 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ofu A  11 TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINVDFADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADMRDELHVTVVATGLG 317
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       


Chain B from PDB  Type:PROTEIN  Length:307
 aligned with FTSZ_PSEAE | P47204 from UniProtKB/Swiss-Prot  Length:394

    Alignment length:307
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       
           FTSZ_PSEAE    11 TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINVDFADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADMRDELHVTVVATGLG 317
               SCOP domains d1ofub1 B:11-208 Cell-division protein FtsZ                                                                                                                                                           d1ofub2 B:209-317 Cell-division protein FtsZ                                                                  SCOP domains
               CATH domains -1ofuB01 B:12-224  [code=3.40.50.1440, no name defined]                                                                                                                                                               1ofuB02 B:225-317  [code=3.30.1330.20, no name defined]                                       CATH domains
           Pfam domains (1) --Tubulin-1ofuB03 B:13-185                                                                                                                                                     ------------------------------------FtsZ_C-1ofuB01 B:222-317                                                                         Pfam domains (1)
           Pfam domains (2) --Tubulin-1ofuB04 B:13-185                                                                                                                                                     ------------------------------------FtsZ_C-1ofuB02 B:222-317                                                                         Pfam domains (2)
         Sec.struct. author ...eeeeeehhhhhhhhhhhhhh.....eeeeee..hhhhh.....eeee.hhhhhh......hhhhhhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhhh..eeeeeeee.hhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh..eeeeeeeeee...hhhhhhhhhhhhhhhhh..hhhhh.eeeeeeee....hhhhhhhhhhhhhhhh....eeeeeeee.......eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------FTSZ_1  PDB: B:44-78 UniProt: 44-78------------------FTSZ_2  PDB: B:97-118 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ofu B  11 TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINVDFADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADMRDELHVTVVATGLG 317
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       


Chain X from PDB  Type:PROTEIN  Length:119
 aligned with SULA_PSEAE | Q9HZJ8 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:119
                                    52        62        72        82        92       102       112       122       132       142       152         
           SULA_PSEAE    43 PAAFSELSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALALSCEALRLGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNIRLG 161
               SCOP domains d1ofux_ X: Hypothetical protein PA3008                                                                                  SCOP domains
               CATH domains 1ofuX00 X:43-161 P-loop containing nucleotide triphosphate hydrolases                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.hhhhhhhhhhhhhhhhh......eeeee......hhhhhhhh......eeee...hhhhhhhhhhhhhhhh.eeeeee.....hhhhhhhhhhhhhhhh.eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 1ofu X  43 PAAFSELSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALALSCEALRLGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNIRLG 161
                                    52        62        72        82        92       102       112       122       132       142       152         


Chain Y from PDB  Type:PROTEIN  Length:119
 aligned with SULA_PSEAE | Q9HZJ8 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:119
                                    52        62        72        82        92       102       112       122       132       142       152         
           SULA_PSEAE    43 PAAFSELSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALALSCEALRLGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNIRLG 161
               SCOP domains d1ofuy_ Y: Hypothetical protein PA3008                                                                                  SCOP domains
               CATH domains 1ofuY00 Y:43-161 P-loop containing nucleotide triphosphate hydrolases                                                   CATH domains
           Pfam domains (1) SulA-1ofuY01 Y:43-134                                                                       --------------------------- Pfam domains (1)
           Pfam domains (2) SulA-1ofuY02 Y:43-134                                                                       --------------------------- Pfam domains (2)
         Sec.struct. author ...eeeeeee.hhhhhhhhhhhhhhhhhh.....eeeee......hhhhhhhh......eeee...hhhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhh.eeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 1ofu Y  43 PAAFSELSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALALSCEALRLGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNIRLG 161
                                    52        62        72        82        92       102       112       122       132       142       152
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Clan: Tubulin-like (34)
(-)
Clan: no clan defined [family: SulA] (2)

(-) Gene Ontology  (14, 16)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (FTSZ_PSEAE | P47204)
molecular function
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0043093    FtsZ-dependent cytokinesis    A cytokinesis process that involves a set of conserved proteins including FtsZ, and results in the formation of two similarly sized and shaped cells.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
cellular component
    GO:0032153    cell division site    The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain X,Y   (SULA_PSEAE | Q9HZJ8)
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0009432    SOS response    An error-prone process for repairing damaged microbial DNA.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0051782    negative regulation of cell division    Any process that stops, prevents, or reduces the frequency, rate or extent of cell division.
cellular component
    GO:0009276    Gram-negative-bacterium-type cell wall    The peptidoglycan layer of the Gram-negative cell envelope. In Gram-negative cells the peptidoglycan is relatively thin (1-2nm) and is linked to the outer membrane by lipoproteins. In Gram-negative cells the peptidoglycan is too thin to retain the primary stain in the Gram staining procedure and therefore cells appear red after Gram stain.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu X:134 - Pro X:135   [ RasMol ]  
    Glu Y:134 - Pro Y:135   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ofu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FTSZ_PSEAE | P47204
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  SULA_PSEAE | Q9HZJ8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FTSZ_PSEAE | P47204
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SULA_PSEAE | Q9HZJ8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FTSZ_PSEAE | P47204: 2vaw
        SULA_PSEAE | Q9HZJ8: 1oft

(-) Related Entries Specified in the PDB File

1oft CRYSTAL STRUCTURE OF SULA FROM PSEUDOMONAS AERUGINOSA