1O0P - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE THIRD RNA RECOGNITION MOTIF (RRM) OF U2AF65 IN COMPLEX WITH AN N-TERMINAL SF1 PEPTIDE

Authors :   P. Selenko, G. Gregorovic, R. Sprangers, G. Stier, Z. Rhani, A. Kramer, M. Sattler

Date :   24 Feb 03 (Deposition) - 06 May 03 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (10x)

Keywords :   Non-Canonical Rna Recognition Motif, 4-Stranded Anti- Parallel Beta-Sheet, 2 Alpha Helices Additionally Extended By A Third Helix C, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Selenko, G. Gregorovic, R. Sprangers, G. Stier, Z. Rhani, A. Kramer, M. Sattler
Structural Basis For The Molecular Recognition Between Human Splicing Factors U2Af65 And Sf1/Mbbp
Mol. Cell V. 11 965 2003
PubMed-ID: 12718882 | Reference-DOI: 10.1016/S1097-2765(03)00115-1
(for further references see the PDB file header)

Molecule 1 - SPLICING FACTOR U2AF 65 KDA SUBUNIT
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	MODIFIED PET24D
	Expression System Strain	:	BL21 DE3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	C-TERMINAL RRM DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	U2 AUXILIARY FACTOR 65 KDA SUBUNIT, U2 SNRNP AUXILIARY FACTOR LARGE SUBUNIT, HU2AF(65)

Molecule 2 - SPLICING FACTOR SF1
	Chains	:	B
	Engineered	:	YES
	Fragment	:	N-TERMINAL PEPTIDE
	Other Details	:	THE PEPTIDE WAS CHEMICALLY SYNTHESIZED AND DERIVED FROM THE N-TERMINUS OF SF1. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HOMO SAPIENS (HUMAN).
	Synthetic	:	YES


NMR Structure (10x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1O0P)

(no "Site" information available for 1O0P)

(no "SS Bond" information available for 1O0P)

(no "Cis Peptide Bond" information available for 1O0P)

(no "SAP(SNP)/Variant" information available for 1O0P)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	U2AF2_HUMAN	149-231 259-337 385-466	1	- - A:385-466

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000308924	1	ENSE00001247615	chr19:56165416-56166519	1104	U2AF2_HUMAN	1-17	17	0	-	-
1.2	ENST00000308924	2	ENSE00001172989	chr19:56170576-56170711	136	U2AF2_HUMAN	17-62	46	0	-	-
1.3	ENST00000308924	3	ENSE00000953888	chr19:56171543-56171587	45	U2AF2_HUMAN	62-77	16	0	-	-
1.4	ENST00000308924	4	ENSE00001172973	chr19:56171882-56171985	104	U2AF2_HUMAN	77-112	36	0	-	-
1.5	ENST00000308924	5	ENSE00001178740	chr19:56172404-56172555	152	U2AF2_HUMAN	112-162	51	0	-	-
1.6	ENST00000308924	6	ENSE00001172954	chr19:56173868-56173984	117	U2AF2_HUMAN	163-201	39	0	-	-
1.7	ENST00000308924	7	ENSE00001172945	chr19:56174972-56175110	139	U2AF2_HUMAN	202-248	47	0	-	-
1.8	ENST00000308924	8	ENSE00000876731	chr19:56179873-56179952	80	U2AF2_HUMAN	248-274	27	0	-	-
1.9	ENST00000308924	9	ENSE00001178763	chr19:56180036-56180158	123	U2AF2_HUMAN	275-315	41	0	-	-
1.10b	ENST00000308924	10b	ENSE00001172923	chr19:56180449-56180547	99	U2AF2_HUMAN	316-348	33	0	-	-
1.11	ENST00000308924	11	ENSE00001178717	chr19:56180810-56181058	249	U2AF2_HUMAN	349-431	83	1	A:372-431	60
1.12	ENST00000308924	12	ENSE00001320361	chr19:56185300-56186081	782	U2AF2_HUMAN	432-475	44	1	A:432-475	44

2.1e	ENST00000377390	1e	ENSE00001875721	chr11:64546202-64545834	369	SF01_HUMAN	1-11	11	0	-	-
2.3a	ENST00000377390	3a	ENSE00001681285	chr11:64544098-64543970	129	SF01_HUMAN	11-54	44	1	B:13-25	13
2.4a	ENST00000377390	4a	ENSE00001605002	chr11:64540977-64540902	76	SF01_HUMAN	54-79	26	0	-	-
2.6d	ENST00000377390	6d	ENSE00001732947	chr11:64537880-64537728	153	SF01_HUMAN	79-130	52	0	-	-
2.7	ENST00000377390	7	ENSE00001754448	chr11:64537525-64537436	90	SF01_HUMAN	130-160	31	0	-	-
2.8c	ENST00000377390	8c	ENSE00001781351	chr11:64537081-64536898	184	SF01_HUMAN	160-221	62	0	-	-
2.9b	ENST00000377390	9b	ENSE00001785757	chr11:64536810-64536695	116	SF01_HUMAN	222-260	39	0	-	-
2.10a	ENST00000377390	10a	ENSE00001682227	chr11:64536601-64536494	108	SF01_HUMAN	260-296	37	0	-	-
2.11b	ENST00000377390	11b	ENSE00001711248	chr11:64535758-64535578	181	SF01_HUMAN	296-356	61	0	-	-
2.12a	ENST00000377390	12a	ENSE00000863666	chr11:64535316-64535043	274	SF01_HUMAN	357-448	92	0	-	-
2.13b	ENST00000377390	13b	ENSE00001788125	chr11:64534723-64534664	60	SF01_HUMAN	448-468	21	0	-	-
2.14a	ENST00000377390	14a	ENSE00001645230	chr11:64534551-64534372	180	SF01_HUMAN	468-528	61	0	-	-
2.15f	ENST00000377390	15f	ENSE00001473768	chr11:64533627-64532078	1550	SF01_HUMAN	528-639	112	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:104
 aligned with U2AF2_HUMAN | P26368 from UniProtKB/Swiss-Prot  Length:475

    Alignment length:104
                                   381       391       401       411       421       431       441       451       461       471    
          U2AF2_HUMAN   372 GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 475
               SCOP domains d1o0pa_ A: Splicing factor U2AF 65 KDa subunit                                                           SCOP domains
               CATH domains 1o0pA00 A:372-475  [code=3.30.70.330, no name defined]                                                   CATH domains
               Pfam domains ---------------------------RRM_1-1o0pA01 A:399-460                                       --------------- Pfam domains
         Sec.struct. author .....eeeee.........hhhhhhhhhhhhhhhhh....eeeee..............eeeeee.hhhhhhhhhhhhh.........eeeeehhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------RRM  PDB: A:385-466 UniProt: 385-466                                              --------- PROSITE
               Transcript 1 Exon 1.11  PDB: A:372-431 UniProt: 349-431 [INCOMPLETE]     Exon 1.12  PDB: A:432-475 UniProt: 432-475   Transcript 1
                 1o0p A 372 GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 475
                                   381       391       401       411       421       431       441       451       461       471

Chain B from PDB  Type:PROTEIN  Length:13
 aligned with SF01_HUMAN | Q15637 from UniProtKB/Swiss-Prot  Length:639

    Alignment length:13
                                    22   
           SF01_HUMAN    13 PSKKRKRSRWNQD  25
               SCOP domains ------------- SCOP domains
               CATH domains ------------- CATH domains
               Pfam domains ------------- Pfam domains
         Sec.struct. author ............. Sec.struct. author
                 SAPs(SNPs) ------------- SAPs(SNPs)
                    PROSITE ------------- PROSITE
               Transcript 2 Exon 2.3a     Transcript 2
                 1o0p B  13 PSKKRKRSRWNQD  25
                                    22

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: RNA-binding domain, RBD (289)

Family: Canonical RBD (214)

Protein domain: Splicing factor U2AF 65 KDa subunit (8)

Human (Homo sapiens) [TaxId: 9606] (7)

d1o0pa_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.330, no name defined] (307)

Human (Homo sapiens) (81)

1o0pA00

A:372-475

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: RRM (206)

Family: RRM_1 (131)

Homo sapiens (Human) (94)

RRM_1-1o0pA01

A:399-460

NMR Structure(hide GO term definitions)

Chain A (U2AF2_HUMAN | P26368)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0008187	poly-pyrimidine tract binding	Interacting selectively and non-covalently with any stretch of pyrimidines (cytosine or uracil) in an RNA molecule.
	GO:0030628	pre-mRNA 3'-splice site binding	Interacting selectively and non-covalently with the pre-mRNA 3' splice site sequence.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006405	RNA export from nucleus	The directed movement of RNA from the nucleus to the cytoplasm.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0031124	mRNA 3'-end processing	Any process involved in forming the mature 3' end of an mRNA molecule.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0048025	negative regulation of mRNA splicing, via spliceosome	Any process that stops, prevents or reduces the rate or extent of mRNA splicing via a spliceosomal mechanism.
	GO:0033120	positive regulation of RNA splicing	Any process that activates or increases the frequency, rate or extent of RNA splicing.
	GO:1903955	positive regulation of protein targeting to mitochondrion	Any process that activates or increases the frequency, rate or extent of protein targeting to mitochondrion.
	GO:1903146	regulation of mitophagy	Any process that modulates the frequency, rate or extent of mitochondrion degradation (mitophagy).
	GO:0006369	termination of RNA polymerase II transcription	The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
cellular component
	GO:0000974	Prp19 complex	A protein complex consisting of Prp19 and associated proteins that is involved in the transition from the precatalytic spliceosome to the activated form that catalyzes step 1 of splicing, and which remains associated with the spliceosome through the second catalytic step. It is widely conserved, found in both yeast and mammals, though the exact composition varies. In S. cerevisiae, it contains Prp19p, Ntc20p, Snt309p, Isy1p, Syf2p, Cwc2p, Prp46p, Clf1p, Cef1p, and Syf1p.
	GO:0071004	U2-type prespliceosome	A spliceosomal complex that is formed by association of the 5' splice site with the U1 snRNP, while the branch point sequence is recognized by the U2 snRNP. The prespliceosome includes many proteins in addition to those found in the U1 and U2 snRNPs. Commitment to a given pair of 5' and 3' splice sites occurs at the time of prespliceosome formation.
	GO:0089701	U2AF	A heterodimeric protein complex consisting of conserved large and small U2AF subunits that contributes to spliceosomal RNA splicing by binding to consensus sequences at the 3' splice site. U2AF is required to stabilize the association of the U2 snRNP with the branch point.
	GO:0000243	commitment complex	A spliceosomal complex that is formed by association of the U1 snRNP with the 5' splice site of an unspliced intron in an RNA transcript.
	GO:0016607	nuclear speck	A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Chain B (SF01_HUMAN | Q15637)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003714	transcription corepressor activity	Interacting selectively and non-covalently with a repressing transcription factor and also with the basal transcription machinery in order to stop, prevent, or reduce the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between repressive transcription factors and the basal transcription machinery.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0033327	Leydig cell differentiation	The process in which a relatively unspecialized cell acquires specialized structural and/or functional features of a Leydig cell. A Leydig cell is a testosterone-secreting cell in the interstitial area, between the seminiferous tubules, in the testis.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0000389	mRNA 3'-splice site recognition	Recognition of the intron 3'-splice site by components of the assembling U2- or U12-type spliceosome.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0030238	male sex determination	The specification of male sex of an individual organism.
	GO:1903507	negative regulation of nucleic acid-templated transcription	Any process that stops, prevents or reduces the frequency, rate or extent of nucleic acid-templated transcription.
	GO:0048662	negative regulation of smooth muscle cell proliferation	Any process that stops, prevents or reduces the rate or extent of smooth muscle cell proliferation.
	GO:0050810	regulation of steroid biosynthetic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0000245	spliceosomal complex assembly	The aggregation, arrangement and bonding together of a spliceosomal complex, a ribonucleoprotein apparatus that catalyzes nuclear mRNA splicing via transesterification reactions.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1o0p)

	Sites
(no "Sites" information available for 1o0p)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1o0p)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1o0p
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SF01_HUMAN \| Q15637
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	U2AF2_HUMAN \| P26368
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SF01_HUMAN \| Q15637
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	U2AF2_HUMAN \| P26368
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1O0P)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (40, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File