|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
NMR Structure (1, 1)
|
NMR Structure (1, 1)
|
(no "SS Bond" information available for 1NIN) |
NMR Structure
|
(no "SAP(SNP)/Variant" information available for 1NIN) |
NMR Structure (1, 1)
|
(no "Exon" information available for 1NIN) |
NMR StructureChain A from PDB Type:PROTEIN Length:105 aligned with PLAS_ANAVA | P0C178 from UniProtKB/Swiss-Prot Length:105 Alignment length:105 10 20 30 40 50 60 70 80 90 100 PLAS_ANAVA 1 ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG 105 SCOP domains d1nina_ A: Plastocyanin SCOP domains CATH domains 1ninA00 A:1-105 Cupredoxins - blue copper proteins CATH domains Pfam domains --Copper-bind-1ninA01 A:3-104 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 1nin A 1 ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG 105 10 20 30 40 50 60 70 80 90 100 Chain A from PDB Type:PROTEIN Length:105 aligned with PLAS_ANAVT | Q3M9H8 from UniProtKB/Swiss-Prot Length:139 Alignment length:105 44 54 64 74 84 94 104 114 124 134 PLAS_ANAVT 35 ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDATLNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGDYSFYCEPHRGAGMVGKITVAS 139 SCOP domains d1nina_ A: Plastocyanin SCOP domains CATH domains 1ninA00 A:1-105 Cupredoxins - blue copper proteins CATH domains Pfam domains --Copper-bind-1ninA01 A:3-104 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 1nin A 1 ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG 105 10 20 30 40 50 60 70 80 90 100
|
NMR Structure
|
NMR Structure |
NMR Structure |
NMR Structure(hide GO term definitions) Chain A (PLAS_ANAVT | Q3M9H8)
Chain A (PLAS_ANAVA | P0C178)
|
|
|
|
|
|
|