Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HUMAN GGA1 GAT DOMAIN
 
Authors :  B. M. Collins, P. J. Watson, D. J. Owen
Date :  27 Nov 02  (Deposition) - 25 Mar 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Clathrin-Adaptor, Gga, Gat Domain, Helical Paper-Clip, Three-Helix Bundle, Signaling Protein, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. M. Collins, P. J. Watson, D. J. Owen
The Structure Of The Gga1-Gat Domain Reveals The Molecular Basis For Arf Binding And Membrane Association Of Ggas
Dev. Cell V. 4 321 2003
PubMed-ID: 12636914  |  Reference-DOI: 10.1016/S1534-5807(03)00037-6
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System StrainBL21(DE3)/PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentGAT DOMAIN, RESIDUES 165-314 OF SWS Q9UJY5
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGGA1 APPENDAGE DOMAIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 7)

Asymmetric/Biological Unit (1, 7)
No.NameCountTypeFull Name
1MSE7Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1NAF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NAF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NAF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NAF)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GATPS50909 GAT domain profile.GGA1_HUMAN171-299  1A:171-299

(-) Exons   (5, 5)

Asymmetric/Biological Unit (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003436321aENSE00001813421chr22:38004482-38004910429GGA1_HUMAN1-15150--
1.7cENST000003436327cENSE00002140158chr22:38010197-3801028185GGA1_HUMAN15-43290--
1.8aENST000003436328aENSE00001612880chr22:38012929-3801300476GGA1_HUMAN43-68260--
1.9cENST000003436329cENSE00001683976chr22:38014455-3801455399GGA1_HUMAN69-101330--
1.10fENST0000034363210fENSE00000880168chr22:38016245-38016368124GGA1_HUMAN102-143420--
1.11bENST0000034363211bENSE00000880169chr22:38016820-38016920101GGA1_HUMAN143-176341A:171-1766
1.12cENST0000034363212cENSE00000653934chr22:38017623-3801770381GGA1_HUMAN177-203271A:177-20327
1.13ENST0000034363213ENSE00000880172chr22:38019334-38019474141GGA1_HUMAN204-250471A:204-250 (gaps)47
1.14bENST0000034363214bENSE00000880174chr22:38019559-3801964082GGA1_HUMAN251-278281A:251-27828
1.14eENST0000034363214eENSE00001286815chr22:38020976-38021083108GGA1_HUMAN278-314371A:278-29922
1.15aENST0000034363215aENSE00000653938chr22:38021804-38021956153GGA1_HUMAN314-365520--
1.16ENST0000034363216ENSE00000653944chr22:38025469-3802553365GGA1_HUMAN365-386220--
1.17aENST0000034363217aENSE00000653945chr22:38026005-38026177173GGA1_HUMAN387-444580--
1.18bENST0000034363218bENSE00000653946chr22:38026910-38027106197GGA1_HUMAN444-510670--
1.19ENST0000034363219ENSE00000653947chr22:38028003-38028172170GGA1_HUMAN510-566570--
1.20ENST0000034363220ENSE00000653948chr22:38028412-38028522111GGA1_HUMAN567-603370--
1.21dENST0000034363221dENSE00001823052chr22:38028608-38029571964GGA1_HUMAN604-639360--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:124
 aligned with GGA1_HUMAN | Q9UJY5 from UniProtKB/Swiss-Prot  Length:639

    Alignment length:129
                                   180       190       200       210       220       230       240       250       260       270       280       290         
           GGA1_HUMAN   171 DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR 299
               SCOP domains d1nafa_ A: ADP-ribosylation factor binding protein Gga1                                                                           SCOP domains
               CATH domains 1nafA01 A:171-209                      1nafA02 A:210-299  [code=1.20     .58.160, no name defined]                                CATH domains
               Pfam domains -----------------------------------GAT-1nafA01 A:206-299                                                                          Pfam domains
         Sec.struct. author .hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...-----...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GAT  PDB: A:171-299 UniProt: 171-299                                                                                              PROSITE
           Transcript 1 (1) 1.11b Exon 1.12c  PDB: A:177-203 Exon 1.13  PDB: A:204-250 (gaps)               Exon 1.14b  PDB: A:251-278  --------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------Exon 1.14e             Transcript 1 (2)
                 1naf A 171 DEEKSKmLARLLKSSHPEDLRAANKLIKEmVQEDQKRmEKISKRVNAIEEVNNNVKLLTEmVmSHSQG-----SSEDLmKELYQRCERmRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR 299
                                  |180       190       200       210       220       230| |    | -   |   250       260       270       280       290         
                                  |                    200-MSE 208-MSE                231-MSE238   244    |       259-MSE                                    
                                177-MSE                                                 233-MSE         249-MSE                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (17, 17)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (GGA1_HUMAN | Q9UJY5)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0006886    intracellular protein transport    The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
    GO:0045732    positive regulation of protein catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:1901998    toxin transport    The directed movement of a toxin into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0030131    clathrin adaptor complex    A membrane coat adaptor complex that links clathrin to a membrane.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1naf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1naf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1naf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GGA1_HUMAN | Q9UJY5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GGA1_HUMAN | Q9UJY5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GGA1_HUMAN | Q9UJY51j2j 1jwf 1jwg 1na8 1nwm 1o3x 1om9 1oxz 1py1 1ujj 1ujk 1x79 2dwx 2dwy 3g2s 3g2t 3g2u 3g2v 3g2w

(-) Related Entries Specified in the PDB File

1gyu STRUCTURE OF THE APPENDAGE DOMAIN OF GAMMA-ADAPTIN
1na8