1ML3 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   EVIDENCES FOR A FLIP-FLOP CATALYTIC MECHANISM OF TRYPANOSOMA CRUZI GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, FROM ITS CRYSTAL STRUCTURE IN COMPLEX WITH REACTED IRREVERSIBLE INHIBITOR 2-(2-PHOSPHONO-ETHYL)-ACRYLIC ACID 4-NITRO-PHENYL ESTER

Authors :   M. S. Castilho, F. Pavao, G. Oliva

Date :   29 Aug 02 (Deposition) - 08 Jul 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Protein Covalent-Inhibitor Complex, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. S. Castilho, F. Pavao, G. Oliva, S. Ladame, M. Willson, J. Perie
Evidence For The Two Phosphate Binding Sites Of An Analogue Of The Thioacyl Intermediate For The Trypanosoma Cruzi Glyceraldehyde-3-Phosphate Dehydrogenase-Catalyzed Reaction, From Its Crystal Structure.
Biochemistry V. 42 7143 2003
PubMed-ID: 12795610 | Reference-DOI: 10.1021/BI0206107
(for further references see the PDB file header)

Molecule 1 - GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE, GLYCOSOMAL
	Chains	:	A, B, C, D
	EC Number	:	1.2.1.12
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PET3A
	Gene	:	GAPDH
	Organism Scientific	:	TRYPANOSOMA CRUZI
	Organism Taxid	:	5693
	Synonym	:	GAPDH

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 6)

No.	Name	Count	Type	Full Name
1	CYX	3	Ligand/Ion	(3-FORMYL-BUT-3-ENYL)-PHOSPHONIC ACID
2	NAD	3	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	VAL B:206 , GLY C:9 , GLY C:11 , ARG C:12 , ILE C:13 , ASP C:38 , MET C:39 , ALA C:90 , GLN C:91 , SER C:110 , THR C:111 , GLY C:112 , SER C:134 , ALA C:135 , CYS C:166 , ALA C:198 , ASN C:335 , TYR C:339 , CYX C:2166 , HOH C:2211 , HOH C:2222 , HOH C:2230 , HOH C:2274	BINDING SITE FOR RESIDUE NAD C 1360
2	AC2	SOFTWARE	ASN D:8 , GLY D:9 , GLY D:11 , ARG D:12 , ILE D:13 , VAL D:37 , ASP D:38 , MET D:39 , ALA D:90 , GLN D:91 , SER D:110 , THR D:111 , GLY D:112 , LEU D:113 , SER D:134 , ALA D:135 , ALA D:198 , ASN D:335 , TYR D:339 , CYX D:3166 , HOH D:3168 , HOH D:3174 , HOH D:3191 , HOH D:3192 , HOH D:3216 , HOH D:3301	BINDING SITE FOR RESIDUE NAD D 1361
3	AC3	SOFTWARE	GLY B:9 , GLY B:11 , ARG B:12 , ILE B:13 , ASP B:38 , MET B:39 , ALA B:90 , ARG B:92 , LEU B:113 , ALA B:135 , CYS B:166 , ALA B:198 , ASN B:335 , TYR B:339 , CYX B:1166 , HOH B:1450 , HOH B:1465 , HOH B:1516 , VAL C:206	BINDING SITE FOR RESIDUE NAD B 1362
4	AC4	SOFTWARE	CYS B:166 , THR B:167 , HIS B:194 , THR B:197 , THR B:226 , SER B:247 , ARG B:249 , NAD B:1362	BINDING SITE FOR RESIDUE CYX B 1166
5	AC5	SOFTWARE	SER C:165 , CYS C:166 , THR C:167 , HIS C:194 , THR C:197 , THR C:199 , THR C:225 , THR C:226 , SER C:247 , ARG C:249 , ASN C:335 , NAD C:1360 , HOH C:2274	BINDING SITE FOR RESIDUE CYX C 2166
6	AC6	SOFTWARE	CYS D:166 , HIS D:194 , THR D:197 , THR D:199 , ARG D:249 , ASN D:335 , NAD D:1361	BINDING SITE FOR RESIDUE CYX D 3166

(no "SS Bond" information available for 1ML3)

(no "Cis Peptide Bond" information available for 1ML3)

(no "SAP(SNP)/Variant" information available for 1ML3)

Asymmetric/Biological Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GAPDH	PS00071	Glyceraldehyde 3-phosphate dehydrogenase active site.	G3PG_TRYCR	164-171	4	A:164-171 B:164-171 C:164-171 D:164-171

(no "Exon" information available for 1ML3)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:359
 aligned with G3PG_TRYCR | P22513 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350         
           G3PG_TRYCR     1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
               SCOP domains d1ml3a1 A:1-164,A:334-359 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                          d1ml3a2 A:165-333 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                                       d1ml3a1 A:1-164,A:334-359  SCOP domains
               CATH domains -1ml3A01 A:2-164,A:336-355 NAD(P)-binding Rossmann-like Domain                                                                                                      1ml3A02 A:165-335 Dihydrodipicolinate Reductase; domain 2                                                                                                                  1ml3A01             ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh......eeeeeeee...hhhhhhhhhhh..........eeee..........eeee..eeeeeee...hhhhhhhhhhh..eeee......hhhhhhhhhhh...eeee........ee.....hhhhh......eee....hhhhhhhhhhhhhhh.....eeeeeeeee...............hhhhhhhhhh.eeee.hhhhhhhhhhhhhh..eeeeeeee.....eeeeeeee.....hhhhhhhhhhhhhhh.....eeee....hhhhhh.....eeeehhhhhhh.......eeeeeeee..hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------GAPDH   -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ml3 A   1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350

Chain B from PDB  Type:PROTEIN  Length:359
 aligned with G3PG_TRYCR | P22513 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350         
           G3PG_TRYCR     1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
               SCOP domains d1ml3b1 B:1-164,B:334-359 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                          d1ml3b2 B:165-333 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                                       d1ml3b1 B:1-164,B:334-359  SCOP domains
               CATH domains -1ml3B01 B:2-164,B:336-355 NAD(P)-binding Rossmann-like Domain                                                                                                      1ml3B02 B:165-335 Dihydrodipicolinate Reductase; domain 2                                                                                                                  1ml3B01             ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh......eeeee......hhhhhhhhhhh..........eeee..........eeee..eeee......hhhhhhhhhhh..eeee........hhhhhhhhh...eeee........ee.....hhhhh......eee....hhhhhhhhhhhhhhh.....eeeeeeeee...............hhhhhhhhhh.eeee.hhhhhhhhhhhhhh..eeeeeeee.....eeeeeeee.....hhhhhhhhhhhhhh......eeee....hhhhhh.....eeeehhhhhh........eeeeeeee..hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------GAPDH   -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ml3 B   1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350

Chain C from PDB  Type:PROTEIN  Length:359
 aligned with G3PG_TRYCR | P22513 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350         
           G3PG_TRYCR     1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
               SCOP domains d1ml3c1 C:1-164,C:334-359 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                          d1ml3c2 C:165-333 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                                       d1ml3c1 C:1-164,C:334-359  SCOP domains
               CATH domains -1ml3C01 C:2-164,C:336-355 NAD(P)-binding Rossmann-like Domain                                                                                                      1ml3C02 C:165-335 Dihydrodipicolinate Reductase; domain 2                                                                                                                  1ml3C01             ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhhhh........eeeeee...hhhhhhhhhhh............ee..........ee......eeeee...hhhhh........eeee........hhhhhhhhh....eee...............hhhhh......eee....hhhhhhhhhhhhhhh...eeeeeeeeeee...............hhhhhhhhhh.eeee.hhhhhhhhhhhhhh..eeeeeeee.....eeeeeeeee....hhhhhhhhhhhhhhh.....eeee....hhhhhh.....eeeehhhhhh........eeeeeeee..hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------GAPDH   -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ml3 C   1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350

Chain D from PDB  Type:PROTEIN  Length:359
 aligned with G3PG_TRYCR | P22513 from UniProtKB/Swiss-Prot  Length:359

    Alignment length:359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350         
           G3PG_TRYCR     1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
               SCOP domains d1ml3d1 D:1-164,D:334-359 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                          d1ml3d2 D:165-333 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)                                                                                                       d1ml3d1 D:1-164,D:334-359  SCOP domains
               CATH domains -1ml3D01 D:2-164,D:336-355 NAD(P)-binding Rossmann-like Domain                                                                                                      1ml3D02 D:165-335 Dihydrodipicolinate Reductase; domain 2                                                                                                                  1ml3D01             ---- CATH domains
           Pfam domains (1) --Gp_dh_N-1ml3D05 D:3-166                                                                                                                                             ----Gp_dh_C-1ml3D01 D:171-333                                                                                                                                          -------------------------- Pfam domains (1)
           Pfam domains (2) --Gp_dh_N-1ml3D06 D:3-166                                                                                                                                             ----Gp_dh_C-1ml3D02 D:171-333                                                                                                                                          -------------------------- Pfam domains (2)
           Pfam domains (3) --Gp_dh_N-1ml3D07 D:3-166                                                                                                                                             ----Gp_dh_C-1ml3D03 D:171-333                                                                                                                                          -------------------------- Pfam domains (3)
           Pfam domains (4) --Gp_dh_N-1ml3D08 D:3-166                                                                                                                                             ----Gp_dh_C-1ml3D04 D:171-333                                                                                                                                          -------------------------- Pfam domains (4)
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhh......eeeeeeee...hhhhhhhhhhee...ee....eeee..........eeee..eeeeeee...hhhhhhhhhhh..eeee......hhhhhhhhhhh...eeee........ee.....hhhhh......eee..hhhhhhhhhhhhhhhhh...eeeeeeeeeee...............hhhhhhhhhh.eeee....hhhhhhhhhhh..eeeeeeee.....eeeeeeeee....hhhhhhhhhhhhhhh.....eeee....hhhhhh.....eeeehhhhhh........eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------GAPDH   -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ml3 D   1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL 359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: FwdE/GAPDH domain-like (188)

Superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain (179)

Family: GAPDH-like (99)

Protein domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (61)

Trypanosoma cruzi [TaxId: 5693] (5)

1a	d1ml3a2	A:165-333
1b	d1ml3b2	B:165-333
1c	d1ml3c2	C:165-333
1d	d1ml3d2	D:165-333

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain (179)

Protein domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (61)

Trypanosoma cruzi [TaxId: 5693] (5)

2a	d1ml3a1	A:1-164,A:334-359
2b	d1ml3b1	B:1-164,B:334-359
2c	d1ml3c1	C:1-164,C:334-359
2d	d1ml3d1	D:1-164,D:334-359

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Dihydrodipicolinate Reductase; domain 2 (182)

Homologous Superfamily: Dihydrodipicolinate Reductase; domain 2 (178)

Trypanosoma cruzi. Organism_taxid: 5693. (2)

1a	1ml3A02	A:165-335
1b	1ml3B02	B:165-335
1c	1ml3C02	C:165-335
1d	1ml3D02	D:165-335

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Trypanosoma cruzi. Organism_taxid: 5693. (2)

2a	1ml3A01	A:2-164,A:336-355
2b	1ml3B01	B:2-164,B:336-355
2c	1ml3C01	C:2-164,C:336-355
2d	1ml3D01	D:2-164,D:336-355

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: GADPH_aa-bio_dh (59)

Family: Gp_dh_C (38)

Trypanosoma cruzi (2)

1a	Gp_dh_C-1ml3D01	D:171-333
1b	Gp_dh_C-1ml3D02	D:171-333
1c	Gp_dh_C-1ml3D03	D:171-333
1d	Gp_dh_C-1ml3D04	D:171-333

Clan: NADP_Rossmann (1239)

Family: Gp_dh_N (38)

Trypanosoma cruzi (2)

2a	Gp_dh_N-1ml3D05	D:3-166
2b	Gp_dh_N-1ml3D06	D:3-166
2c	Gp_dh_N-1ml3D07	D:3-166
2d	Gp_dh_N-1ml3D08	D:3-166

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (G3PG_TRYCR | P22513)

molecular function
	GO:0051287	NAD binding	Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
	GO:0050661	NADP binding	Interacting selectively and non-covalently with nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
	GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	Catalysis of the reaction: D-glyceraldehyde 3-phosphate + phosphate + NAD+ = 3-phospho-D-glyceroyl phosphate + NADH + H+.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016620	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which an aldehyde or ketone (oxo) group acts as a hydrogen or electron donor and reduces NAD or NADP.
biological process
	GO:0006006	glucose metabolic process	The chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. D-glucose is dextrorotatory and is sometimes known as dextrose; it is an important source of energy for living organisms and is found free as well as combined in homo- and hetero-oligosaccharides and polysaccharides.
	GO:0006096	glycolytic process	The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0020015	glycosome	A membrane-bounded organelle found in organisms from the order Kinetoplastida that houses the enzymes of glycolysis.
	GO:0005777	peroxisome	A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CYX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ml3)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ml3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	G3PG_TRYCR \| P22513
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.2.1.12
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	G3PG_TRYCR \| P22513
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	G3PG_TRYCR \| P22513	:	1k3t 1qxs 3dmt 3ids

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (2, 8)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File