Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF APOCOPC FROM PSEUDOMONAS SYRINGAE
 
Authors :  F. Arnesano, L. Banci, I. Bertini, A. R. Thompsett
Date :  02 Jul 02  (Deposition) - 06 Nov 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Cupredoxins, Copper Trafficking, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Arnesano, L. Banci, I. Bertini, A. R. Thompsett
Solution Structure Of Copc: A Cupredoxin-Like Protein Involved In Copper Homeostasis
Structure V. 10 1337 2002
PubMed-ID: 12377120  |  Reference-DOI: 10.1016/S0969-2126(02)00858-4
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COPPER RESISTANCE PROTEIN C
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET20B
    Expression System Strain: BL21(DE3)PLYS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: COPC
    Organism Scientific: PSEUDOMONAS SYRINGAE
    Organism Taxid: 317

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1M42)

(-) Sites  (0, 0)

(no "Site" information available for 1M42)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1M42)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1M42)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1M42)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1M42)

(-) Exons   (0, 0)

(no "Exon" information available for 1M42)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:102
 aligned with COPC_PSEUB | P12376 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:102
                                    34        44        54        64        74        84        94       104       114       124  
           COPC_PSEUB    25 HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK 126
               SCOP domains d1m42a_ A: Copper resistance protein C (CopC, PcoC)                                                    SCOP domains
               CATH domains 1m42A00 A:1-102  [code=2.60.40.1220, no name defined]                                                  CATH domains
               Pfam domains CopC-1m42A01 A:1-102                                                                                   Pfam domains
         Sec.struct. author ...eeeee.....ee.....eeeee.........eeeeee..........eee.eeeee.....eeeeee......eeeeeeeee.......eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------ Transcript
                 1m42 A   1 HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK 102
                                    10        20        30        40        50        60        70        80        90       100  


Chain A from PDB  Type:PROTEIN  Length:102
 aligned with Q4ZWC7_PSEU2 | Q4ZWC7 from UniProtKB/TrEMBL  Length:126

    Alignment length:102
                                    34        44        54        64        74        84        94       104       114       124  
         Q4ZWC7_PSEU2    25 HPKLVSSTPAEGSEGAAPGKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMGVKTAVSGGGDPKTMIITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK 126
               SCOP domains d1m42a_ A: Copper resistance protein C (CopC, PcoC)                                                    SCOP domains
               CATH domains 1m42A00 A:1-102  [code=2.60.40.1220, no name defined]                                                  CATH domains
               Pfam domains CopC-1m42A01 A:1-102                                                                                   Pfam domains
         Sec.struct. author ...eeeee.....ee.....eeeee.........eeeeee..........eee.eeeee.....eeeeee......eeeeeeeee.......eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------ Transcript
                 1m42 A   1 HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK 102
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: E-set (290)

(-) Gene Ontology  (4, 7)

NMR Structure(hide GO term definitions)
Chain A   (Q4ZWC7_PSEU2 | Q4ZWC7)
molecular function
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
biological process
    GO:0046688    response to copper ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a copper ion stimulus.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain A   (COPC_PSEUB | P12376)
molecular function
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0046688    response to copper ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a copper ion stimulus.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1m42)
 
  Sites
(no "Sites" information available for 1m42)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1m42)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1m42
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COPC_PSEUB | P12376
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q4ZWC7_PSEU2 | Q4ZWC7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COPC_PSEUB | P12376
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q4ZWC7_PSEU2 | Q4ZWC7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COPC_PSEUB | P12376: 1nm4 1ot4 2c9p 2c9q 2c9r
UniProtKB/TrEMBL
        Q4ZWC7_PSEU2 | Q4ZWC7: 1nm4 1ot4

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1M42)