1M1R - JenaLib

Title :   REDUCED P222 CRYSTAL STRUCTURE OF THE TETRAHEME CYTOCHROME C OF SHEWANELLA ONEIDENSIS MR1

Authors :   D. Leys, T. E. Meyer, A. I. Tsapin, K. H. Nealson, M. A. Cusanovich, J. J. Van Beeumen

Date :   20 Jun 02 (Deposition) - 14 Aug 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.02

Chains :   Asym./Biol. Unit : A

Keywords :   Reduced Structure, Atomic Resolution, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. Leys, T. E. Meyer, A. I. Tsapin, K. H. Nealson, M. A. Cusanovich, J. J. Van Beeumen
Crystal Structures At Atomic Resolution Reveal The Novel Concept Of 'Electron-Harvesting' As A Role For The Small Tetraheme Cytochrome C
J. Biol. Chem. V. 277 35703 2002
PubMed-ID: 12080059 | Reference-DOI: 10.1074/JBC.M203866200
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:25 , ALA A:26 , ASP A:27 , ALA A:86 , HOH A:1046 , HOH A:1071 , HOH A:1094 , HOH A:1103 , HOH A:1120 , HOH A:1131 , HOH A:1204	BINDING SITE FOR RESIDUE SO4 A 117
2	AC2	SOFTWARE	GLU A:11 , SER A:12 , LYS A:50 , HIS A:79 , ASP A:80 , ASP A:81 , ARG A:83 , HOH A:1035 , HOH A:1036 , HOH A:1135 , HOH A:1136 , HOH A:1199	BINDING SITE FOR RESIDUE SO4 A 118
3	AC3	SOFTWARE	SER A:6 , HIS A:9 , CYS A:15 , SER A:17 , CYS A:18 , HIS A:19 , PRO A:24 , SER A:25 , GLY A:28 , ALA A:29 , PHE A:30 , GLU A:31 , GLN A:34 , ALA A:63 , VAL A:64 , HIS A:65 , LYS A:90 , HEM A:802 , HOH A:1039 , HOH A:1055 , HOH A:1059 , HOH A:1113 , HOH A:1122 , HOH A:1177 , HOH A:1179 , HOH A:1184	BINDING SITE FOR RESIDUE HEM A 801
4	AC4	SOFTWARE	GLN A:3 , PHE A:8 , GLU A:11 , PRO A:51 , HIS A:52 , LEU A:56 , CYS A:75 , SER A:77 , CYS A:78 , HIS A:79 , ARG A:83 , THR A:84 , HEM A:803 , HOH A:1112 , HOH A:1136 , HOH A:1161 , HOH A:1164	BINDING SITE FOR RESIDUE HEM A 804
5	AC5	SOFTWARE	LEU A:5 , HIS A:9 , SER A:17 , GLN A:34 , CYS A:35 , CYS A:38 , HIS A:39 , CYS A:58 , HIS A:62 , VAL A:69 , LYS A:72 , SER A:77 , LYS A:91 , HEM A:801 , HEM A:803 , HOH A:1037 , HOH A:1061 , HOH A:1087 , HOH A:1153 , HOH A:1240	BINDING SITE FOR RESIDUE HEM A 802
6	AC6	SOFTWARE	HIS A:39 , LEU A:42 , ASP A:46 , VAL A:48 , HIS A:49 , HIS A:52 , CYS A:58 , CYS A:61 , HIS A:62 , LYS A:72 , PRO A:73 , SER A:85 , HEM A:802 , HEM A:804 , HOH A:1038 , HOH A:1251 , HOH A:1263 , HOH A:1264 , HOH A:1286	BINDING SITE FOR RESIDUE HEM A 803

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:91
 aligned with Q8EDL6_SHEON | Q8EDL6 from UniProtKB/TrEMBL  Length:116

    Alignment length:91
                                    35        45        55        65        75        85        95       105       115 
         Q8EDL6_SHEON    26 ADQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK 116
               SCOP domains d1m1ra_ A: Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain           SCOP domains
               CATH domains 1m1rA00 A:1-91 Flavocytochrome C3; Chain A                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhh...hhhhh......................hhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 1m1r A   1 ADQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK  91
                                    10        20        30        40        50        60        70        80        90

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (Q8EDL6_SHEON | Q8EDL6)

molecular function
	GO:0009055		electron carrier activity		Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0046872		metal ion binding		Interacting selectively and non-covalently with any metal ion.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1m1r)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1m1r
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q8EDL6_SHEON \| Q8EDL6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q8EDL6_SHEON \| Q8EDL6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description