1LXS - JenaLib

Theor.Model - manually (Jmol Viewer)

Theoretical Model (Jmol Viewer)

Title :   THEORETICAL MODEL OF THE CATALYTIC DOMAIN OF 3',5'-CYCLIC NUCLEOTIDE PHOSPHODIESTERASE 1C

Authors :   S. Sunitatajne, S. Ramadevi, K. Srikanth

Date :   06 Jun 02 (Deposition) - 26 Jun 02 (Release) - 20 Nov 02 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A

Keywords :   Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Sunitatajne, S. Ramadevi, K. Srikanth
Theoretical Model Of The Catalytic Domain Of 3', 5'-Cyclic Nucleotide Phosphodiesterase 1C
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - 3',5'-CYCLIC NUCLEOTIDE PHOSPHODIESTERASE 1C
	Chains	:	A
	EC Number	:	3.1.4.17
	Fragment	:	RESIDUES 1-298
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Synonym	:	CALCIUM/CALMODULIN-DEPENDENT 3',5'-CYCLIC NUCLEOTIDE PHOSPHODIESTERASE 1C


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1LXS)

(no "Site" information available for 1LXS)

(no "SS Bond" information available for 1LXS)

Theoretical Model

No.	Residues
1	Glu A:285	-	Lys A:286

(no "SAP(SNP)/Variant" information available for 1LXS)

Theoretical Model (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE1C_HUMAN	268-279	1	A:106-117

Theoretical Model (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.6b	ENST00000396191	6b	ENSE00001524194	chr7:32110461-32109905	557	PDE1C_HUMAN	1-34	34	0	-	-
1.7	ENST00000396191	7	ENSE00001017114	chr7:32091192-32091166	27	PDE1C_HUMAN	34-43	10	0	-	-
1.8b	ENST00000396191	8b	ENSE00001123687	chr7:31920473-31920360	114	PDE1C_HUMAN	43-81	39	0	-	-
1.9b	ENST00000396191	9b	ENSE00001123680	chr7:31918791-31918609	183	PDE1C_HUMAN	81-142	62	0	-	-
1.10	ENST00000396191	10	ENSE00001123670	chr7:31917649-31917583	67	PDE1C_HUMAN	142-164	23	1	A:1-2	2
1.11b	ENST00000396191	11b	ENSE00001123662	chr7:31913021-31912905	117	PDE1C_HUMAN	165-203	39	1	A:3-41	39
1.12b	ENST00000396191	12b	ENSE00001123654	chr7:31904696-31904556	141	PDE1C_HUMAN	204-250	47	1	A:42-88	47
1.13b	ENST00000396191	13b	ENSE00001123649	chr7:31890355-31890255	101	PDE1C_HUMAN	251-284	34	1	A:89-122	34
1.14a	ENST00000396191	14a	ENSE00001123646	chr7:31887710-31887582	129	PDE1C_HUMAN	284-327	44	1	A:122-165	44
1.15	ENST00000396191	15	ENSE00001123640	chr7:31877585-31877484	102	PDE1C_HUMAN	327-361	35	1	A:165-199	35
1.16	ENST00000396191	16	ENSE00001123635	chr7:31876914-31876794	121	PDE1C_HUMAN	361-401	41	1	A:199-239	41
1.17	ENST00000396191	17	ENSE00001123631	chr7:31867987-31867906	82	PDE1C_HUMAN	402-429	28	1	A:240-267	28
1.18	ENST00000396191	18	ENSE00001123627	chr7:31864601-31864481	121	PDE1C_HUMAN	429-469	41	1	A:267-298	32
1.19	ENST00000396191	19	ENSE00001123622	chr7:31862862-31862687	176	PDE1C_HUMAN	469-528	60	0	-	-
1.21	ENST00000396191	21	ENSE00001123614	chr7:31855768-31855538	231	PDE1C_HUMAN	528-605	78	0	-	-
1.22	ENST00000396191	22	ENSE00001123608	chr7:31848722-31848645	78	PDE1C_HUMAN	605-631	27	0	-	-
1.24	ENST00000396191	24	ENSE00001123599	chr7:31815346-31815278	69	PDE1C_HUMAN	631-654	24	0	-	-
1.25b	ENST00000396191	25b	ENSE00001434206	chr7:31793167-31792632	536	PDE1C_HUMAN	654-709	56	0	-	-

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:298
 aligned with PDE1C_HUMAN | Q14123 from UniProtKB/Swiss-Prot  Length:709

    Alignment length:298
                                   172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452        
          PDE1C_HUMAN   163 LKDVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQT 460
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------PDEASE_I    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.Exon 1.11b  PDB: A:3-41                Exon 1.12b  PDB: A:42-88 UniProt: 204-250      Exon 1.13b  PDB: A:89-122         ------------------------------------------Exon 1.15  PDB: A:165-199          ----------------------------------------Exon 1.17  PDB: A:240-267   ------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------Exon 1.14a  PDB: A:122-165 UniProt: 284-327 ---------------------------------Exon 1.16  PDB: A:199-239                ---------------------------Exon 1.18  PDB: A:267-298        Transcript 1 (2)
                 1lxs A   1 LKDVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQT 298
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1LXS)

(no "CATH Domain" information available for 1LXS)

(no "Pfam Domain" information available for 1LXS)

Theoretical Model(hide GO term definitions)

Chain A (PDE1C_HUMAN | Q14123)

molecular function
	GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	Catalysis of the reaction: nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0004117	calmodulin-dependent cyclic-nucleotide phosphodiesterase activity	Catalysis of the reaction: nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate; catalytic activity is regulated by calmodulin.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008081	phosphoric diester hydrolase activity	Catalysis of the hydrolysis of a phosphodiester to give a phosphomonoester and a free hydroxyl group.
biological process
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1lxs)

	Sites
(no "Sites" information available for 1lxs)

	Cis Peptide Bonds
		Glu A:285 - Lys A:286	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1lxs
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PDE1C_HUMAN \| Q14123
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.4.17
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PDE1C_HUMAN \| Q14123
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1LXS)

(no "Related Entries Specified in the PDB File" available for 1LXS)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File