1LTO - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
         TRYB1_HUMAN     31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK  273
               SCOP domains d1ltoa_ A: Alpha tryptase I                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ltoA01     1ltoA02 A:28-120,A:233-244 Trypsin-like serine proteases                                         1ltoA01 A:16-27,A:121-232 Trypsin-like serine proteases                                                                   1ltoA02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeeeee..eeeehhhhhh....hhh.eeeee.............eeeeee.....hhhhh...eeeee..........................eeeeee................eeeeee..hhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: A:16-243 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: A:16-60A UniProt: 21-78          ----------------------------------------------------------------------------------------Exon 1.4  PDB: A:149-192 UniProt: 167-221              Exon 1.5b  PDB: A:193-244 (gaps) UniProt: 222-275    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.3a  PDB: A:60A-149 (gaps) UniProt: 78-167                                          ---------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                1lto A   16 IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPK  244
                                    25        35  ||    43        53       60C||      68      ||81        91       101       111       121       131       141     ||152||     160       170   |||173G||     181       191       201       211     |221A       231       241   
                                                37A|                     60A||||             75|                                                                 147|   ||                  173A||||||||                                         217|  |                       
                                                 37B                      60B|||              79                                                                  149   ||                   173B|||||||                                          219  |                       
                                                                           60C||                                                                                     152A|                    173C||||||                                            221A                       
                                                                            60D|                                                                                      152B                     173D|||||                                                                       
                                                                             60E                                                                                                                173E||||                                                                       
                                                                                                                                                                                                 173F|||                                                                       
                                                                                                                                                                                                  173G||                                                                       
                                                                                                                                                                                                   173H|                                                                       
                                                                                                                                                                                                    173I

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
         TRYB1_HUMAN     31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK  273
               SCOP domains d1ltob_ B: Alpha tryptase I                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ltoB01     1ltoB02 B:28-120,B:233-244 Trypsin-like serine proteases                                         1ltoB01 B:16-27,B:121-232 Trypsin-like serine proteases                                                                   1ltoB02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeeeee..eeeehhhhhh....hhh.eeee..............eeeeee.....hhhhh...eeeee..........................eeeeee................eeeeeeeehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: B:16-243 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: B:16-60A UniProt: 21-78          ----------------------------------------------------------------------------------------Exon 1.4  PDB: B:149-192 UniProt: 167-221              Exon 1.5b  PDB: B:193-244 (gaps) UniProt: 222-275    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.3a  PDB: B:60A-149 (gaps) UniProt: 78-167                                          ---------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                1lto B   16 IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPK  244
                                    25        35  ||    43        53       60C||      68      ||81        91       101       111       121       131       141     ||152||     160       170   |||173G||     181       191       201       211     |221A       231       241   
                                                37A|                     60A||||             75|                                                                 147|   ||                  173A||||||||                                         217|  |                       
                                                 37B                      60B|||              79                                                                  149   ||                   173B|||||||                                          219  |                       
                                                                           60C||                                                                                     152A|                    173C||||||                                            221A                       
                                                                            60D|                                                                                      152B                     173D|||||                                                                       
                                                                             60E                                                                                                                173E||||                                                                       
                                                                                                                                                                                                 173F|||                                                                       
                                                                                                                                                                                                  173G||                                                                       
                                                                                                                                                                                                   173H|                                                                       
                                                                                                                                                                                                    173I

Chain C from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
         TRYB1_HUMAN     31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK  273
               SCOP domains d1ltoc_ C: Alpha tryptase I                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ltoC01     1ltoC02 C:28-120,C:233-244 Trypsin-like serine proteases                                         1ltoC01 C:16-27,C:121-232 Trypsin-like serine proteases                                                                   1ltoC02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeeeee..eeeehhhhhh....hhh.eeee............eeeeeeee.....hhhhh...eeeee..........................eeeeee................eeeeee..hhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: C:16-243 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: C:16-60A UniProt: 21-78          ----------------------------------------------------------------------------------------Exon 1.4  PDB: C:149-192 UniProt: 167-221              Exon 1.5b  PDB: C:193-244 (gaps) UniProt: 222-275    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.3a  PDB: C:60A-149 (gaps) UniProt: 78-167                                          ---------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                1lto C   16 IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPK  244
                                    25        35  ||    43        53       60C||      68      ||81        91       101       111       121       131       141     ||152||     160       170   |||173G||     181       191       201       211     |221A       231       241   
                                                37A|                     60A||||             75|                                                                 147|   ||                  173A||||||||                                         217|  |                       
                                                 37B                      60B|||              79                                                                  149   ||                   173B|||||||                                          219  |                       
                                                                           60C||                                                                                     152A|                    173C||||||                                            221A                       
                                                                            60D|                                                                                      152B                     173D|||||                                                                       
                                                                             60E                                                                                                                173E||||                                                                       
                                                                                                                                                                                                 173F|||                                                                       
                                                                                                                                                                                                  173G||                                                                       
                                                                                                                                                                                                   173H|                                                                       
                                                                                                                                                                                                    173I

Chain D from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
         TRYB1_HUMAN     31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK  273
               SCOP domains d1ltod_ D: Alpha tryptase I                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ltoD01     1ltoD02 D:28-120,D:233-244 Trypsin-like serine proteases                                         1ltoD01 D:16-27,D:121-232 Trypsin-like serine proteases                                                                   1ltoD02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeeeee..eeeehhhhhh....hhh.eeee..............eeeeee.....hhhhh...eeeee...........................eeeee................eeee..eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeeehhhhhhhhh..... Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: D:16-243 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: D:16-60A UniProt: 21-78          ----------------------------------------------------------------------------------------Exon 1.4  PDB: D:149-192 UniProt: 167-221              Exon 1.5b  PDB: D:193-244 (gaps) UniProt: 222-275    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.3a  PDB: D:60A-149 (gaps) UniProt: 78-167                                          ---------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                1lto D   16 IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPK  244
                                    25        35  ||    43        53       60C||      68      ||81        91       101       111       121       131       141     ||152||     160       170   |||173G||     181       191       201       211     |221A       231       241   
                                                37A|                     60A||||             75|                                                                 147|   ||                  173A||||||||                                         217|  |                       
                                                 37B                      60B|||              79                                                                  149   ||                   173B|||||||                                          219  |                       
                                                                           60C||                                                                                     152A|                    173C||||||                                            221A                       
                                                                            60D|                                                                                      152B                     173D|||||                                                                       
                                                                             60E                                                                                                                173E||||                                                                       
                                                                                                                                                                                                 173F|||                                                                       
                                                                                                                                                                                                  173G||                                                                       
                                                                                                                                                                                                   173H|                                                                       
                                                                                                                                                                                                    173I

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (TRYB1_HUMAN | Q15661)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006952	defense response	Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (16, 16)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (22, 88)

PROSITE Motifs (3, 12)

Exons (4, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 8)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File