Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN TRYPTASE WITH POTENT NON-PEPTIDE INHIBITOR
 
Authors :  J. C. Spurlino, S. A. Barnakov, F. Lewandowski, C. Milligan
Date :  02 Oct 07  (Deposition) - 26 Feb 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Tryptase, Serine Protease, Tetramer, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. J. Costanzo, S. C. Yabut, H. -C. Zhang, K. B. White, L. De Garavilla, Y. Wang, L. K. Minor, B. A. Tounge, A. N. Barnakov, F. Lewandowski, C. Milligan, J. C. Spurlino, W. M. Abraham, V. Boswell-Smith, C. P. Page, B. E. Maryanoff
Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase. Synthesis And Biological Evaluation Of Novel Spirocyclic Piperidine Amide Derivatives
Bioorg. Med. Chem. Lett. V. 18 2114 2008
PubMed-ID: 18272363  |  Reference-DOI: 10.1016/J.BMCL.2008.01.093
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRYPTASE BETA 2
    ChainsA, B, C, D
    EC Number3.4.21.59
    EngineeredYES
    Expression SystemPICHIA PASTORIS
    Expression System Taxid4922
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 31-275
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
12FF4Ligand/Ion(5-(AMINOMETHYL)-2H-SPIRO[BENZOFURAN-3,4'-PIPERIDINE]-1'-YL)(5-(PHENYLETHYNYL)FURAN-2-YL)METHANONE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN B:102 , TYR B:177 , ILE B:189 , ASP B:203 , SER B:204 , CYS B:205 , GLN B:206 , SER B:209 , TRP B:229 , GLY B:230 , GLU B:231 , GLY B:232 , HOH B:305 , ASP D:64 , TYR D:99BINDING SITE FOR RESIDUE 2FF B 1
2AC2SOFTWARETYR A:177 , ASP A:203 , SER A:204 , CYS A:205 , GLN A:206 , SER A:209 , TRP A:229 , GLY A:230 , GLU A:231 , GLY A:232 , ARG A:238 , GLY A:240 , HOH A:272 , ASP C:64BINDING SITE FOR RESIDUE 2FF A 4
3AC3SOFTWAREASP B:64 , TYR D:177 , ILE D:189 , ASP D:203 , SER D:204 , CYS D:205 , GLN D:206 , SER D:209 , TRP D:229 , GLY D:230 , GLU D:231 , GLY D:232 , ARG D:238BINDING SITE FOR RESIDUE 2FF D 3
4AC4SOFTWAREASP A:64 , GLN C:102 , TYR C:177 , ILE C:189 , ASP C:203 , SER C:204 , CYS C:205 , GLN C:206 , SER C:209 , TRP C:229 , GLY C:230 , GLU C:231 , GLY C:232 , ARG C:238 , HOH C:263 , HOH C:285BINDING SITE FOR RESIDUE 2FF C 2

(-) SS Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1A:44 -A:60
2A:140 -A:215
3A:173 -A:196
4A:205 -A:233
5B:44 -B:60
6B:140 -B:215
7B:173 -B:196
8B:205 -B:233
9C:44 -C:60
10C:140 -C:215
11C:173 -C:196
12C:205 -C:233
13D:44 -D:60
14D:140 -D:215
15D:173 -D:196
16D:205 -D:233

(-) Cis Peptide Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1Gly A:62 -Pro A:63
2Pro A:156 -Pro A:157
3Gly B:62 -Pro B:63
4Pro B:156 -Pro B:157
5Gly C:62 -Pro C:63
6Pro C:156 -Pro C:157
7Gly D:62 -Pro D:63
8Pro D:156 -Pro D:157

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (22, 88)

Asymmetric/Biological Unit (22, 88)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_064281H51RTRYB1_HUMANPolymorphism1060281A/B/C/DH36R
02UniProtVAR_064282G52DTRYB1_HUMANPolymorphism17841227A/B/C/DG37D
03UniProtVAR_064283P53RTRYB1_HUMANPolymorphism17841226A/B/C/DP38R
04UniProtVAR_064284V76LTRYB1_HUMANPolymorphism71384640A/B/C/DV61L
05UniProtVAR_014559A85TTRYB1_HUMANPolymorphism1141968A/B/C/DA70T
06UniProtVAR_064285T115ITRYB1_HUMANPolymorphism1064774A/B/C/DT100I
07UniProtVAR_064286A116ITRYB1_HUMANPolymorphism  ---A/B/C/DA101I
08UniProtVAR_064287I118TTRYB1_HUMANPolymorphism71376589A/B/C/DI103T
09UniProtVAR_016102N132KTRYB1_HUMANPolymorphism1800991A/B/C/DK117K
10UniProtVAR_064288V133ITRYB1_HUMANPolymorphism1064779A/B/C/DV118I
11UniProtVAR_051830H136RTRYB1_HUMANPolymorphism1064780A/B/C/DH121R
12UniProtVAR_014560T141ATRYB1_HUMANPolymorphism1800992A/B/C/DT126A
13UniProtVAR_064289T141MTRYB1_HUMANPolymorphism  ---A/B/C/DT126M
14UniProtVAR_014561D162NTRYB1_HUMANPolymorphism2234641A/B/C/DD147N
15UniProtVAR_064290R168PTRYB1_HUMANPolymorphism1141969A/B/C/DR153P
16UniProtVAR_014562P170STRYB1_HUMANPolymorphism2234904A/B/C/DP155S
17UniProtVAR_064291V205ITRYB1_HUMANPolymorphism1060284A/B/C/DV190I
18UniProtVAR_014563T215STRYB1_HUMANPolymorphism2234905A/B/C/DT200S
19UniProtVAR_014564R216QTRYB1_HUMANPolymorphism2234906A/B/C/DR201Q
20UniProtVAR_064292Q221KTRYB1_HUMANPolymorphism17841224A/B/C/DQ206K
21UniProtVAR_064293G245DTRYB1_HUMANPolymorphism1060292A/B/C/DG230D
22UniProtVAR_064294Y263NTRYB1_HUMANPolymorphism2234646A/B/C/DY248N

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 12)

Asymmetric/Biological Unit (3, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.TRYB1_HUMAN31-272
 
 
 
  4A:16-257
B:16-257
C:16-257
D:16-257
TRYB2_HUMAN31-272
 
 
 
  4A:16-257
B:16-257
C:16-257
D:16-257
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.TRYB1_HUMAN70-75
 
 
 
  4A:55-60
B:55-60
C:55-60
D:55-60
TRYB2_HUMAN70-75
 
 
 
  4A:55-60
B:55-60
C:55-60
D:55-60
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.TRYB1_HUMAN218-229
 
 
 
  4A:203-214
B:203-214
C:203-214
D:203-214
TRYB2_HUMAN218-229
 
 
 
  4A:203-214
B:203-214
C:203-214
D:203-214

(-) Exons   (0, 0)

(no "Exon" information available for 2ZA5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB1_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5a_ A: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5A01     2za5A02 A:28-124,A:247-258 Trypsin-like serine proteases                                         2za5A01 A:16-27,A:125-246 Trypsin-like serine proteases                                                                   2za5A02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhhh....hhh.eeee...........ee.eeeeee.............eeeee...........................eeeee................eeee..eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: A:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 A  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

Chain A from PDB  Type:PROTEIN  Length:243
 aligned with TRYB2_HUMAN | P20231 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB2_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5a_ A: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5A01     2za5A02 A:28-124,A:247-258 Trypsin-like serine proteases                                         2za5A01 A:16-27,A:125-246 Trypsin-like serine proteases                                                                   2za5A02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhhh....hhh.eeee...........ee.eeeeee.............eeeee...........................eeeee................eeee..eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (2) TRYPSIN_DOM  PDB: A:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 A  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB1_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5b_ B: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5B01     2za5B02 B:28-124,B:247-258 Trypsin-like serine proteases                                         2za5B01 B:16-27,B:125-246 Trypsin-like serine proteases                                                                   2za5B02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhhh....hhh.eeee..............eeeeee.............eeeee...........................eeeee................eeee..eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: B:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 B  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with TRYB2_HUMAN | P20231 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB2_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5b_ B: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5B01     2za5B02 B:28-124,B:247-258 Trypsin-like serine proteases                                         2za5B01 B:16-27,B:125-246 Trypsin-like serine proteases                                                                   2za5B02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhhh....hhh.eeee..............eeeeee.............eeeee...........................eeeee................eeee..eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (2) TRYPSIN_DOM  PDB: B:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 B  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

Chain C from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB1_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5c_ C: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5C01     2za5C02 C:28-124,C:247-258 Trypsin-like serine proteases                                         2za5C01 C:16-27,C:125-246 Trypsin-like serine proteases                                                                   2za5C02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhhh....hhh.eeee............eeeeeeee.............eeeee...........................eeeee................eeeee.eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: C:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 C  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

Chain C from PDB  Type:PROTEIN  Length:243
 aligned with TRYB2_HUMAN | P20231 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB2_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5c_ C: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5C01     2za5C02 C:28-124,C:247-258 Trypsin-like serine proteases                                         2za5C01 C:16-27,C:125-246 Trypsin-like serine proteases                                                                   2za5C02      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhhh....hhh.eeee............eeeeeeee.............eeeee...........................eeeee................eeeee.eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (2) TRYPSIN_DOM  PDB: C:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 C  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

Chain D from PDB  Type:PROTEIN  Length:243
 aligned with TRYB1_HUMAN | Q15661 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB1_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5d_ D: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5D01     2za5D02 D:28-124,D:247-258 Trypsin-like serine proteases                                         2za5D01 D:16-27,D:125-246 Trypsin-like serine proteases                                                                   2za5D02      CATH domains
           Pfam domains (1) Trypsin-2za5D01 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (1)
           Pfam domains (2) Trypsin-2za5D02 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (2)
           Pfam domains (3) Trypsin-2za5D03 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (3)
           Pfam domains (4) Trypsin-2za5D04 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (4)
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhh.....hhh.eeee............eeeeeeee.............eeeee...........................eeeee................eeee..eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) TRYPSIN_DOM  PDB: D:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 D  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

Chain D from PDB  Type:PROTEIN  Length:243
 aligned with TRYB2_HUMAN | P20231 from UniProtKB/Swiss-Prot  Length:275

    Alignment length:243
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   
          TRYB2_HUMAN    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273
               SCOP domains d2za5d_ D: beta-Tryptase                                                                                                                                                                                                                            SCOP domains
               CATH domains 2za5D01     2za5D02 D:28-124,D:247-258 Trypsin-like serine proteases                                         2za5D01 D:16-27,D:125-246 Trypsin-like serine proteases                                                                   2za5D02      CATH domains
           Pfam domains (1) Trypsin-2za5D01 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (1)
           Pfam domains (2) Trypsin-2za5D02 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (2)
           Pfam domains (3) Trypsin-2za5D03 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (3)
           Pfam domains (4) Trypsin-2za5D04 D:16-252                                                                                                                                                                                                                     ------ Pfam domains (4)
         Sec.struct. author ....ee........eeeeee.....eeeeeeeeee..eeeehhhhh.....hhh.eeee............eeeeeeee.............eeeee...........................eeeee................eeee..eehhhhhhhhhhh..............eeee..............eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------RDR----------------------L--------T-----------------------------II-T-------------KI--R----A--------------------N-----P-S----------------------------------I---------SQ----K-----------------------D-----------------N---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (2) TRYPSIN_DOM  PDB: D:16-257 UniProt: 31-272                                                                                                                                                                                                        - PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER -------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2za5 D  16 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 258
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 8)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)
1a2za5A02A:28-124,A:247-258
1b2za5A01A:16-27,A:125-246
1c2za5B01B:16-27,B:125-246
1d2za5C01C:16-27,C:125-246
1e2za5D01D:16-27,D:125-246
1f2za5B02B:28-124,B:247-258
1g2za5C02C:28-124,C:247-258
1h2za5D02D:28-124,D:247-258

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit

(-) Gene Ontology  (11, 18)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (TRYB2_HUMAN | P20231)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain A,B,C,D   (TRYB1_HUMAN | Q15661)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2FF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:62 - Pro A:63   [ RasMol ]  
    Gly B:62 - Pro B:63   [ RasMol ]  
    Gly C:62 - Pro C:63   [ RasMol ]  
    Gly D:62 - Pro D:63   [ RasMol ]  
    Pro A:156 - Pro A:157   [ RasMol ]  
    Pro B:156 - Pro B:157   [ RasMol ]  
    Pro C:156 - Pro C:157   [ RasMol ]  
    Pro D:156 - Pro D:157   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2za5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRYB1_HUMAN | Q15661
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TRYB2_HUMAN | P20231
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.59
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRYB1_HUMAN | Q15661
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRYB2_HUMAN | P20231
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRYB1_HUMAN | Q156611lto 2f9n 2f9o 2f9p 2zeb 2zec 4a6l 4mpu 4mpv 4mpw 4mpx 4mqa 5f03
        TRYB2_HUMAN | P202311a0l 1aao 2bm2 2fpz 2fs8 2fs9 2fww 2fxr 2gdd 3v7t

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ZA5)